TkA02G402760 | RubberDandelionOmics

Gene overview

TkA02G402760

Reference: TK1151 Chr: Chr02 Coordinates: 102287094-102290966 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3261 bp · TkA02G402760|TK1151|cDNA

GCAAAGCATCCTTTTCCCCTGATCCGATCGACTCTAATCTTTCTTTACGTTTACCAATTTGGACCTTTGCATATGGCGGACCCCACGCTTCACACACTTTCGTCCCCTTCCTTCTTAGCTTTTGCATGAATAGGCCACACTTTACTCCAATCGGTTCTCTCCGCCGCTCACCTCCACTTAATTTCTCTATCATTCCTCTATAATTGTAACCTATTTGTCAGGTGAACTTCCGTTATTCATGGTTTCAGTTTATTCCTTTT...

CDS

Download CDS FASTA

2256 bp · TkA02G402760|TK1151|CDS

ATGGGGGCCACAAACTCGAAAGTGGAAGAAGACAAAGCTCTCCAACTATGTCGTGAAAGGAAAAAGTTTGTTAGAAAAGCACTTGATGGAAGATGTTCACTTGCAGCCACTCATTTCACTTACATAGAGTCTTTAACAATCATAGGTAAAGCATTAAGAAGATTTGTAGAACCTGAAGCTCCCATGGAGTCCTCATTATACACATCCACTAATGCAACTCCTGATCCTCACACATTCATTGAAAAATCCCTTTCTCAATT...

Protein

Download Protein FASTA

751 aa · TkA02G402760|TK1151|PROTEIN

MGATNSKVEEDKALQLCRERKKFVRKALDGRCSLAATHFTYIESLTIIGKALRRFVEPEAPMESSLYTSTNATPDPHTFIEKSLSQFSFSSTTSQHIGPPGNRSPSPSPPTSTRYFSNHMKVRGSVSKKVEEKPVLAVLGSVTSSSTPRTEHLHEHDHDHEHEIPFDPPSMFPEDQPWDFFGLEHPIDNDFEVRELRTPEKEQQKEEMSVNLEEESEDEFDEPSRDGLVRSFENVNRVVVGDSVSGPGPGPGLHSMSSVE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G402760`
TK1151 ID	TkA02G402760
OH-1004 ID	LXL04_014717
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G402760

Location Chr02:102287094-102290966 (+)

Description Similar to APSR1: Protein ALTERED PHOSPHATE STARVATION RESPONSE 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g51290`	Required for the coordination of cell differentiation and cell elongation in the root tip.	No verified direct reference in this release
`At3g60320`	Required for nitrate signaling.	The Arabidopsis NRG2 Protein Mediates Nitrate Signaling and Interacts with and Regulates Key Nitrate Regulators.2016 · DOI: 10.1105/tpc.15.00567

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0562700`	Involved in the regulation of leaf shape formation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014717 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0010073 meristem maintenance Biological Process

GO:0010167 response to nitrate Biological Process

GO:0015706 nitrate transmembrane transport Biological Process

GO:0030154 cell differentiation Biological Process

GO:0071249 cellular response to nitrate Biological Process

GO:0071705 nitrogen compound transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT3G51290

ath:AT3G60320

dosa:Os10g0562700

osa:4349394

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.496

Rank 1 · TkA02G402760 · TK1151

Cytoplasm0.338

Rank 2 · TkA02G402760 · TK1151

Nucleus0.304

Rank 3 · TkA02G402760 · TK1151

Endoplasmic reticulum0.052

Rank 4 · TkA02G402760 · TK1151

Plastid0.033

Rank 5 · TkA02G402760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04783DUF6301-59 aa

PF04782DUF632322-662 aa

PF15753BLOC1S3378-526 aa

PF11932DUF3450435-537 aa

PF31021RBSN_mid452-529 aa

PF04783DUF630594-602 aa

PF31021RBSN_mid733-749 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G402760	`PF04783`	DUF630	1	59	4.1e-23	82.0
TkA02G402760	`PF04782`	DUF632	322	662	1.5e-106	357.0
TkA02G402760	`PF15753`	BLOC1S3	378	526	0.038	14.7
TkA02G402760	`PF11932`	DUF3450	435	537	0.021	14.9
TkA02G402760	`PF31021`	RBSN_mid	452	529	1.6	10.1
TkA02G402760	`PF04783`	DUF630	594	602	4.1e-23	82.0
TkA02G402760	`PF31021`	RBSN_mid	733	749	1.6	10.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A0A178VBJ0`	Arabidopsis thaliana	sp\|A0A178VBJ0\|APSR1_ARATH Protein ALTERED PHOSPHATE STARVATION RESPONSE 1	33.300%	Swiss-Prot	Low
`Q93YU8`	Arabidopsis thaliana	sp\|Q93YU8\|NRG2_ARATH Nitrate regulatory gene2 protein	33.500%	Swiss-Prot	Low
`Q9AQW1`	Oryza sativa subsp. japonica	sp\|Q9AQW1\|REL2_ORYSJ Protein ROLLING AND ERECT LEAF 2	28.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card