TkA02G402230 | RubberDandelionOmics

Gene overview

TkA02G402230

Reference: TK1151 Chr: Chr02 Coordinates: 102143605-102145289 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1245 bp · TkA02G402230|TK1151|cDNA

GTTGCGTTGCGAGTACATGTCACCGCAAGTCCGTACCGAATACCGAGCAGGCGAACACCCTCCTTCCCTCTTCTTCTTTCCTCCGTCGTGGGGTTGATATTGCAGCCGCTCGTCACCACCGCGAAGCTGTCAAACCCCTCAAGTTGGAGAATTGAAGTAGTTCTGTTTATTTTGCTCTTATGGCGTTTGAACTGAATCTCACAATTACTCTGTTTTGTTGCTAAGCCAAAAACTTCGAATTTGCTGACTACTGCCATCAT...

CDS

Download CDS FASTA

825 bp · TkA02G402230|TK1151|CDS

ATGATGAACTTTACCAGTGCAACCAAAACCCCCATTTCTTCATCAAACCGTAACTCAGTTCTTTTGCACAGATGGTGGCTAATAAAGGTCGAAGGGGAGTCCAAATTGGGCGTTGGAGGCTATGTTAACAGAGAGACACTAGGATCACGAGGAAGACGACTTTTGGGATCAGCATCATTTGGCAAGATTCGCAACCTTAATACAGAAAATCAAACAGAAAATAAAGTGTTTTGTTCTACACCAATCAGCAAAAGGGTTGA...

Protein

Download Protein FASTA

274 aa · TkA02G402230|TK1151|PROTEIN

MMNFTSATKTPISSSNRNSVLLHRWWLIKVEGESKLGVGGYVNRETLGSRGRRLLGSASFGKIRNLNTENQTENKVFCSTPISKRVDNNTLETIDGITIMIIGSIHQSRTLYYGFSPEVCDHFLSGFPFDWEEYPDKISRKKCETSFNDLPVTWAREILMSNTQESETCDFTSMIVNDILKQCTQDTFTQTQVQLDHKQDDNLVKGIEEAHEINSFPVEDLGNSKETEAARISSRAGSLCESRLDPKRKQCDTSRLLEGK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G402230`
TK1151 ID	TkA02G402230
OH-1004 ID	LXL04_000549
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	35.200
Protein coverage (%)	TK1151 51.460 / OH-1004 25.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G402230`
Location	Chr02:102143605-102145289 (-)
Description	Similar to KNL2: Kinetochore-associated protein KNL-2 homolog
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_000549` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0034080 CENP-A containing chromatin assembly Biological Process GO:0051301 cell division Biological Process GO:0051321 meiotic cell cycle Biological Process GO:0000775 chromosome, centromeric region Cellular Component GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005730 nucleolus Cellular Component GO:0005886 plasma membrane Cellular Component GO:0010369 chromocenter Cellular Component GO:0016604 nuclear body Cellular Component GO:0003677 DNA binding Molecular Function GO:0003723 RNA binding Molecular Function
KEGG gene cross-reference	ath:AT1G58210 ath:AT5G02520 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.898

Rank 1 · TkA02G402230 · TK1151

Cytoplasm0.199

Rank 2 · TkA02G402230 · TK1151

Cell membrane0.031

Rank 3 · TkA02G402230 · TK1151

Mitochondrion0.022

Rank 4 · TkA02G402230 · TK1151

Endoplasmic reticulum0.014

Rank 5 · TkA02G402230 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09133SANTA20-46 aa

PF09133SANTA69-134 aa

PF02440Adeno_E3_CR169-115 aa

PF28946LvrA_C131-158 aa

PF02440Adeno_E3_CR1149-198 aa

PF09133SANTA169-197 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G402230	`PF09133`	SANTA	20	46	8.5e-23	81.3
TkA02G402230	`PF09133`	SANTA	69	134	8.5e-23	81.3
TkA02G402230	`PF02440`	Adeno_E3_CR1	69	115	0.42	11.1
TkA02G402230	`PF28946`	LvrA_C	131	158	0.079	14.2
TkA02G402230	`PF02440`	Adeno_E3_CR1	149	198	0.42	11.1
TkA02G402230	`PF09133`	SANTA	169	197	8.5e-23	81.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card