TkA02G396780 | RubberDandelionOmics

Gene overview

TkA02G396780

Reference: TK1151 Chr: Chr02 Coordinates: 100729462-100731317 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1054 bp · TkA02G396780|TK1151|cDNA

AAAAAAGGAAAGAACCCTAAAAAGAAACTAGCCGTTGCAAAGACAAACACGCCGTCGTCAAATCTCAACGTTCGAAAAAAAGGGAAACTTTGCGTGCAAATCTTCTACTAAAACCCCTCTTCCCCTAAACATTTCGGTTGTCTCAAATCTAAACTCAAAACCCCACAATTTCTCTCAAGATTGGAAGAAGAAAGACGAGAAGAGAAGCAATTCTCAATTTCTTCTTCTAATTCTTTTGATTCAGATCCATATTCTGCCCT...

CDS

Download CDS FASTA

558 bp · TkA02G396780|TK1151|CDS

ATGGCAACTATGAACAATCAAGATAGCAACAACAGTAACAACATGACTGCGGCTCCACCCACGAACTCATCGAAACAGCCTCTTCCAACGCCTAAGGCTGTCGACACCCAATCGGTCCTTAAAAGATTACAATCTGAATTGATGGCCTTAATGATGAGTGGTGACTCTGGAATATCTGCTTTTCCTGAAGAAGACAACATATTCTTTTGGAAAGGAACGATTTCAGGGAGCAAAGATACTGTCTTTGAAGGAACAGAATA...

Protein

Download Protein FASTA

185 aa · TkA02G396780|TK1151|PROTEIN

MATMNNQDSNNSNNMTAAPPTNSSKQPLPTPKAVDTQSVLKRLQSELMALMMSGDSGISAFPEEDNIFFWKGTISGSKDTVFEGTEYKLSLSFPNDYPFKPPKVKFETGCFHPNVDVFGNICLDILQDKWSSAYDVRTILISIQSLLGEPNISSPLNTQAAALWGNQEEYRKVVMEKHLYKKPSA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G396780`
TK1151 ID	TkA02G396780
OH-1004 ID	LXL04_020998
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	45.300
Protein coverage (%)	TK1151 73.514 / OH-1004 90.132 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G396780

Location Chr02:100729462-100731317 (+)

Description Similar to UBC2: Ubiquitin-conjugating enzyme E2 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g50490`	Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.	Molecular characterization of plant ubiquitin-conjugating enzymes belonging to the UbcP4/E2-C/UBCx/UbcH10 gene family.2002 · DOI: 10.1104/pp.011353
`At3g20060`	Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.	Molecular characterization of plant ubiquitin-conjugating enzymes belonging to the UbcP4/E2-C/UBCx/UbcH10 gene family.2002 · DOI: 10.1104/pp.011353 UBC19 is a new interacting protein of ORANGE for its nuclear localization in Arabidopsis thaliana .2021 · DOI: 10.1080/15592324.2021.1964847

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020998 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000209 protein polyubiquitination Biological Process

GO:0006281 DNA repair Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004842 ubiquitin-protein transferase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0061631 ubiquitin conjugating enzyme activity Molecular Function

GO:0140936 histone H2B deubiquitinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G14400

ath:AT2G02760

ath:AT5G62540

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.578

Rank 1 · TkA02G396780 · TK1151

Nucleus0.502

Rank 2 · TkA02G396780 · TK1151

Cell membrane0.077

Rank 3 · TkA02G396780 · TK1151

Endoplasmic reticulum0.056

Rank 4 · TkA02G396780 · TK1151

Mitochondrion0.053

Rank 5 · TkA02G396780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00179UQ_con42-176 aa

PF05773RWD83-117 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G396780	`PF00179`	UQ_con	42	176	2.6e-47	160.7
TkA02G396780	`PF05773`	RWD	83	117	0.0047	17.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L7T3`	Arabidopsis thaliana	sp\|Q8L7T3\|UBC20_ARATH Ubiquitin-conjugating enzyme E2 20	82.100%	Swiss-Prot	High
`Q9LJZ5`	Arabidopsis thaliana	sp\|Q9LJZ5\|UBC19_ARATH Ubiquitin-conjugating enzyme E2 19	79.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card