TkA02G395540 | RubberDandelionOmics

Gene overview

TkA02G395540

Reference: TK1151 Chr: Chr02 Coordinates: 100444255-100445946 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1692 bp · TkA02G395540|TK1151|cDNA

ATGCTTCTCCGGCGTACAATCCCTTCGGCCATTTCGTATTCAACCCGCCGGCACCATTCTTCCGCCGCTAGCAGCCTCAAATTTCTCTCAAAAATACCTTATAAATACAGAGCCAAAGCCATTCAACAAGCTCAAGAAGCCCTAACAGATTACCTCCACACAGTCAGAACTATTCCTTACACATTCGCCGAGAACATCAGCAAGCACTCCGTCGTCTCTCTATCTACCGTCATATCGAAAGTTAAATTTTCCACATCCGA...

CDS

Download CDS FASTA

1692 bp · TkA02G395540|TK1151|CDS

ATGCTTCTCCGGCGTACAATCCCTTCGGCCATTTCGTATTCAACCCGCCGGCACCATTCTTCCGCCGCTAGCAGCCTCAAATTTCTCTCAAAAATACCTTATAAATACAGAGCCAAAGCCATTCAACAAGCTCAAGAAGCCCTAACAGATTACCTCCACACAGTCAGAACTATTCCTTACACATTCGCCGAGAACATCAGCAAGCACTCCGTCGTCTCTCTATCTACCGTCATATCGAAAGTTAAATTTTCCACATCCGA...

Protein

Download Protein FASTA

563 aa · TkA02G395540|TK1151|PROTEIN

MLLRRTIPSAISYSTRRHHSSAASSLKFLSKIPYKYRAKAIQQAQEALTDYLHTVRTIPYTFAENISKHSVVSLSTVISKVKFSTSDFSKSLQRFLRYHPVNEFELFFESIGIDINDLNGILPARKFFLSEDLNAFNAACTLYSFGVPWNKLGMLYKEQRTIFDKDPIELQHIWNRFMGYGFTSSSLIGISLVFPHLLNGDTEIDLLFYDLKRVIIDFDLINDVEGNVDEWIDLCRKIRLFYNLDSSKHDVFDMIGKSKH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G395540`
TK1151 ID	TkA02G395540
OH-1004 ID	LXL04_014808
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.800
Protein coverage (%)	TK1151 100.000 / OH-1004 99.823 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G395540

Location Chr02:100444255-100445946 (+)

Description Similar to MTERF18: Transcription termination factor MTEF18, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g60400`	Transcription termination factor involved in the regulation of mitochondrial-encoded gene expression.	Mutations in an Arabidopsis mitochondrial transcription termination factor-related protein enhance thermotolerance in the absence of the major molecular chaperone HSP101.2012 · DOI: 10.1105/tpc.112.101006

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014808 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006353 DNA-templated transcription termination Biological Process

GO:0007005 mitochondrion organization Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009733 response to auxin Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003676 nucleic acid binding Molecular Function

KEGG gene cross-reference

ath:AT3G60400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.795

Rank 1 · TkA02G395540 · TK1151

Plastid0.095

Rank 2 · TkA02G395540 · TK1151

Nucleus0.069

Rank 3 · TkA02G395540 · TK1151

Cytoplasm0.043

Rank 4 · TkA02G395540 · TK1151

Cell membrane0.012

Rank 5 · TkA02G395540 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02536mTERF107-201 aa

PF02536mTERF237-337 aa

PF02536mTERF402-532 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G395540	`PF02536`	mTERF	107	201	5.9e-22	78.7
TkA02G395540	`PF02536`	mTERF	237	337	5.9e-22	78.7
TkA02G395540	`PF02536`	mTERF	402	532	5.9e-22	78.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M219`	Arabidopsis thaliana	sp\|Q9M219\|MTEFH_ARATH Transcription termination factor MTEF18, mitochondrial	47.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card