TkA02G394510 | RubberDandelionOmics

Gene overview

TkA02G394510

Reference: TK1151 Chr: Chr02 Coordinates: 100221634-100223738 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1687 bp · TkA02G394510|TK1151|cDNA

CAAAATCGTCTCAAATCTGTAGTTTGCTTCACGCCTTTGCAACACATTGCTTTTATACATACTTCTCTTCTTTTCATTCTTTTTATTTTAGTTTCCTACACCCCAACAATGTCCAAATTACTATTCCTCCTCCCCCTCTTCTTCTTCCTCTTCCTCCGCCCACACCATGCGGCTGAGGATTTTGTCCGGCAGCCTGCACGGCCCCTTATTCTCACTCCTCATAATCGTCCACAGTCTCATCCTCAACAGGTGCACGTGTC...

CDS

Download CDS FASTA

1428 bp · TkA02G394510|TK1151|CDS

CAAAATCGTCTCAAATCTGTAGTTTGCTTCACGCCTTTGCAACACATTGCTTTTATACATACTTCTCTTCTTTTCATTCTTTTTATTTTAGTTTCCTACACCCCAACAATGTCCAAATTACTATTCCTCCTCCCCCTCTTCTTCTTCCTCTTCCTCCGCCCACACCATGCGGCTGAGGATTTTGTCCGGCAGCCTGCACGGCCCCTTATTCTCACTCCTCATAATCGTCCACAGTCTCATCCTCAACAGGTGCACGTGTC...

Protein

Download Protein FASTA

475 aa · TkA02G394510|TK1151|PROTEIN

QNRLKSVVCFTPLQHIAFIHTSLLFILFILVSYTPTMSKLLFLLPLFFFLFLRPHHAAEDFVRQPARPLILTPHNRPQSHPQQVHVSLVGNNYMKVSWVTDESGVPSTVDYGKRPGIYDSSATGEHTSYRYFFYTSGKIHHVTIGPLDPATTYYYRCGGSGPEFNFRTPTVTYPIEFAIAGDLGQTEWTNTTLEHINATDYDVLLLPGDLSYADTQQPLWDSFGRLVEPYASRRPWMVTQGNHEQEIFPLFYPNGFKAYN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G394510`
TK1151 ID	TkA02G394510
OH-1004 ID	LXL04_014820
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.800
Protein coverage (%)	TK1151 97.474 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G394510

Location Chr02:100221634-100223738 (-)

Description Similar to PAP22: Purple acid phosphatase 22

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g52820`	Purple acid phosphatase 22.	No verified direct reference in this release
`At3g52810`	Purple acid phosphatase 21.	No verified direct reference in this release
`At3g20500`	Purple acid phosphatase 18.	No verified direct reference in this release
`At3g52780`	Probable purple acid phosphatase 20.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014820 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006796 phosphate-containing compound metabolic process Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0003993 acid phosphatase activity Molecular Function

GO:0004721 phosphoprotein phosphatase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G20500

ath:AT3G52780

ath:AT3G52810

ath:AT3G52820

ath:AT4G36350

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.387

Rank 1 · TkA02G394510 · TK1151

Extracellular0.244

Rank 2 · TkA02G394510 · TK1151

Cell membrane0.149

Rank 3 · TkA02G394510 · TK1151

Cytoplasm0.128

Rank 4 · TkA02G394510 · TK1151

Endoplasmic reticulum0.112

Rank 5 · TkA02G394510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16656Pur_ac_phosph_N81-168 aa

PF00149Metallophos177-367 aa

PF14008Metallophos_C382-439 aa

PF00149Metallophos418-451 aa

PF16656Pur_ac_phosph_N426-438 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G394510	`PF16656`	Pur_ac_phosph_N	81	168	4e-21	76.1
TkA02G394510	`PF00149`	Metallophos	177	367	1.3e-21	78.7
TkA02G394510	`PF14008`	Metallophos_C	382	439	9.1e-20	71.8
TkA02G394510	`PF00149`	Metallophos	418	451	1.3e-21	78.7
TkA02G394510	`PF16656`	Pur_ac_phosph_N	426	438	4e-21	76.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8S340`	Arabidopsis thaliana	sp\|Q8S340\|PPA22_ARATH Purple acid phosphatase 22	66.300%	Swiss-Prot	High
`Q9LXI4`	Arabidopsis thaliana	sp\|Q9LXI4\|PPA21_ARATH Purple acid phosphatase 21	62.200%	Swiss-Prot	High
`Q9LJU7`	Arabidopsis thaliana	sp\|Q9LJU7\|PPA18_ARATH Purple acid phosphatase 18	59.600%	Swiss-Prot	High
`Q9LXI7`	Arabidopsis thaliana	sp\|Q9LXI7\|PPA20_ARATH Probable purple acid phosphatase 20	60.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card