TkA02G393850 | RubberDandelionOmics

Gene overview

TkA02G393850

Reference: TK1151 Chr: Chr02 Coordinates: 100062899-100064183 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

936 bp · TkA02G393850|TK1151|cDNA

ATGCGTAAAGTGCTCGTGCAAGAAGTATTGAGCAACAAGAACCTCGAAGCTTCAAGCTCTTTCCGGCGAACTGGAGTGAGAAAAACCATCAAGAATGTATACGACAAAATAGGTACAGAGATGGACATTGGTGGGATCGCGTTCTCCACGTCTCTCACCGTCATAACATGCATGGTATGGAGTAATGGACATTGTGGGAGAGGCGAACATGTCCGACCTTTTCCGGCGCTCACAAGATTCGATATACAGGGGGTGCAACA...

CDS

Download CDS FASTA

936 bp · TkA02G393850|TK1151|CDS

ATGCGTAAAGTGCTCGTGCAAGAAGTATTGAGCAACAAGAACCTCGAAGCTTCAAGCTCTTTCCGGCGAACTGGAGTGAGAAAAACCATCAAGAATGTATACGACAAAATAGGTACAGAGATGGACATTGGTGGGATCGCGTTCTCCACGTCTCTCACCGTCATAACATGCATGGTATGGAGTAATGGACATTGTGGGAGAGGCGAACATGTCCGACCTTTTCCGGCGCTCACAAGATTCGATATACAGGGGGTGCAACA...

Protein

Download Protein FASTA

311 aa · TkA02G393850|TK1151|PROTEIN

MRKVLVQEVLSNKNLEASSSFRRTGVRKTIKNVYDKIGTEMDIGGIAFSTSLTVITCMVWSNGHCGRGEHVRPFPALTRFDIQGVQQKMKNQFKKFDAILQRIIDDRMRLKPEETTDQKGRKDFVQILLELKEQNTASSFNLTQIKAFLVDFFIAGTDTTTVMAEWTMTEILKHPEIMKKIQEELEQVVVPKGSNVYLNVWAIHRDPNYWENPLEFDPDRFLNPDGTTKFSYKGMNTNFLAFGSGRRRCPGVPMAEKMLM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G393850`
TK1151 ID	TkA02G393850
OH-1004 ID	LXL04_014824
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	77.500
Protein coverage (%)	TK1151 100.000 / OH-1004 73.231 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G393850`
Location	Chr02:100062899-100064183 (+)
Description	Similar to CYP93A1: 3,9-dihydroxypterocarpan 6A-monooxygenase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_014824` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006952 defense response Biological Process GO:0009718 anthocyanin-containing compound biosynthetic process Biological Process GO:0016099 monoterpenoid biosynthetic process Biological Process GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0016020 membrane Cellular Component GO:0004497 monooxygenase activity Molecular Function GO:0005506 iron ion binding Molecular Function GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Molecular Function GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen Molecular Function GO:0020037 heme binding Molecular Function GO:0033772 flavonoid 3',5'-hydroxylase activity Molecular Function
KEGG gene cross-reference	ag:CAC80883 gmx:100776878 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.916

Rank 1 · TkA02G393850 · TK1151

Cytoplasm0.065

Rank 2 · TkA02G393850 · TK1151

Cell membrane0.035

Rank 3 · TkA02G393850 · TK1151

Nucleus0.024

Rank 4 · TkA02G393850 · TK1151

Lysosome / Vacuole0.022

Rank 5 · TkA02G393850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067p4501-59 aa

PF13060DUF392120-46 aa

PF05392COX7B21-55 aa

PF00067p45071-189 aa

PF05392COX7B76-93 aa

PF10777YlaC161-204 aa

PF00067p450188-294 aa

PF05392COX7B275-289 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G393850	`PF00067`	p450	1	59	1.8e-51	176.1
TkA02G393850	`PF13060`	DUF3921	20	46	0.27	12.0
TkA02G393850	`PF05392`	COX7B	21	55	0.22	12.0
TkA02G393850	`PF00067`	p450	71	189	1.8e-51	176.1
TkA02G393850	`PF05392`	COX7B	76	93	0.22	12.0
TkA02G393850	`PF10777`	YlaC	161	204	0.074	13.6
TkA02G393850	`PF00067`	p450	188	294	1.8e-51	176.1
TkA02G393850	`PF05392`	COX7B	275	289	0.22	12.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card