TkA02G393520 | RubberDandelionOmics

Gene overview

TkA02G393520

Reference: TK1151 Chr: Chr02 Coordinates: 100007738-100010338 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1337 bp · TkA02G393520|TK1151|cDNA

GTTTTAAATGTAAATTCTTTTCATTTTAATTACGATCTTGGTATTCCAAAGGTTTCGAAGATTTCCTCAAAAAGCAACTGAATTCCGTTGACCGGTTTCACTAATTGAGCTGGACTAATGACTTCCGCCATGAGCAATTCAGAATCCGGTGGGTTTTGGAGGGTATTGTATGTGGTGTTATTGGGTCAATTGGTGTCGTTTGCGATGGCCCTTATGAGCTTCAGTTCATCTTTATCTGCTAATCTAGGCGTTGATGCCCC...

CDS

Download CDS FASTA

999 bp · TkA02G393520|TK1151|CDS

ATGACTTCCGCCATGAGCAATTCAGAATCCGGTGGGTTTTGGAGGGTATTGTATGTGGTGTTATTGGGTCAATTGGTGTCGTTTGCGATGGCCCTTATGAGCTTCAGTTCATCTTTATCTGCTAATCTAGGCGTTGATGCCCCCTTTACTTTGGCATTTTTCTCTTATTTTGCTTTAACTTCGGTTTTCGGAAGTGTTCTACTCTACCGGCGTCAAAAGTTAAAGATTTCTTGGTATTGGTATGTTCTCCTAGGATTTGT...

Protein

Download Protein FASTA

332 aa · TkA02G393520|TK1151|PROTEIN

MTSAMSNSESGGFWRVLYVVLLGQLVSFAMALMSFSSSLSANLGVDAPFTLAFFSYFALTSVFGSVLLYRRQKLKISWYWYVLLGFVDVQGAYFVNKAYQFSSITSVTILDCWTVVWVIILTRIFLGTKYSLWQFFGAALCVSGLCLVLLSDSGVGGSGGPNPVLGDILVIVGTCFFALSNVGEEFCVKKVDRVEVLTMLGLFGMLSSVVEMTLFERKSLVSISWSPEVILTFVGYGISGFMFCSLTPLVLQASGATLFN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G393520`
TK1151 ID	TkA02G393520
OH-1004 ID	LXL04_014832
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G393520`
Location	Chr02:100007738-100010338 (-)
Description	Similar to SLC35F1: Solute carrier family 35 member F1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_014832` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0015871 choline transport Biological Process GO:0160255 tRNA queuosine(34) biosynthetic process from salvaged queuine Biological Process GO:0000139 Golgi membrane Cellular Component GO:0005886 plasma membrane Cellular Component GO:0015220 choline transmembrane transporter activity Molecular Function GO:0022857 transmembrane transporter activity Molecular Function
KEGG gene cross-reference	hsa:222553 hsa:54733 mmu:215085 mmu:72022 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.423

Rank 1 · TkA02G393520 · TK1151

Golgi apparatus0.266

Rank 2 · TkA02G393520 · TK1151

Cytoplasm0.144

Rank 3 · TkA02G393520 · TK1151

Endoplasmic reticulum0.142

Rank 4 · TkA02G393520 · TK1151

Cell membrane0.137

Rank 5 · TkA02G393520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00892EamA9-37 aa

PF06027SLC35F14-301 aa

PF00892EamA20-149 aa

PF18204PGF-CTERM57-72 aa

PF08627CRT-like71-215 aa

PF26436DUF8119115-140 aa

PF18204PGF-CTERM136-148 aa

PF00892EamA165-300 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G393520	`PF00892`	EamA	9	37	2.7e-14	54.3
TkA02G393520	`PF06027`	SLC35F	14	301	1.8e-87	294.4
TkA02G393520	`PF00892`	EamA	20	149	2.7e-14	54.3
TkA02G393520	`PF18204`	PGF-CTERM	57	72	0.35	11.6
TkA02G393520	`PF08627`	CRT-like	71	215	4.2e-08	33.3
TkA02G393520	`PF26436`	DUF8119	115	140	0.82	9.8
TkA02G393520	`PF18204`	PGF-CTERM	136	148	0.35	11.6
TkA02G393520	`PF00892`	EamA	165	300	2.7e-14	54.3
TkA02G393520	`PF18204`	PGF-CTERM	199	209	0.35	11.6
TkA02G393520	`PF26436`	DUF8119	263	296	0.82	9.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card