TkA02G391730 | RubberDandelionOmics

Gene overview

TkA02G391730

Reference: TK1151 Chr: Chr02 Coordinates: 99541159-99546227 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2502 bp · TkA02G391730|TK1151|cDNA

AATCAAACAAGTATAAAAAATTTGATTATATTTTTATTTTTTTAACTTTGATTTGTTTGAAGTTTAAATGAAATAAAGGAAGCAAGTTAAAGAAAGGGATTAGATTATTAGATGCAAACAACAAGAAGAAGAAGGTCGTCGTCTTCGTTCGTCGTCGTTCGTGTCGGGAACGTTACTTACCGCTGACTTCACCATCTCCTCCTCCTCCTCCTCCTCCTCCGCCCTCGCTATTCTCTCTCTAAAACTCCCTAGAGAGAGAA...

CDS

Download CDS FASTA

1494 bp · TkA02G391730|TK1151|CDS

ATGTCGCGATTCACGGCCCTCTTGATCTGGTCGGTTTTTGTACTGTTTCACTATCCTCCGTCGTTCTCATTAAGGTATGTTTCTGCTCTTATAAACGATTCGACCACTGTTATTATCCGGCCTCCACACGCCGGTAGCAATCGCCACACCATGTTTCTACCTCTTTTCCCCTCTCCTCCTAACTCCTCCCGGATCTCCGGCGATGCGAAATCTCGCCGGCACCTCCAGAAATCCGATGCTCGTCGACCTAATGCTCGCAT...

Protein

Download Protein FASTA

497 aa · TkA02G391730|TK1151|PROTEIN

MSRFTALLIWSVFVLFHYPPSFSLRYVSALINDSTTVIIRPPHAGSNRHTMFLPLFPSPPNSSRISGDAKSRRHLQKSDARRPNARMALHDDLLLNGYYTTRLWIGSPPQKFALIVDTGSTVTYVPCATCEQCGKHQDPKFDPDASSTYKPVKCNIDCTCDSNKEQCIYERQYAEMSSSSGVLGEDIISFGNQSDLQPQRAVFGCENRETGDLYSQHADGIMGLGRGDLSIIDQLVDGGVISDSFSLCYGGMDVGGGAMV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G391730`
TK1151 ID	TkA02G391730
OH-1004 ID	LXL04_013590
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	78.900
Protein coverage (%)	TK1151 95.171 / OH-1004 73.313 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G391730

Location Chr02:99541159-99546227 (-)

Description Similar to At1g65240: Aspartic proteinase-like protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g36260`	Displays aspartic proteolytic activity.	No verified direct reference in this release
`At1g09750`	Aspartyl protease AED3.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2ZC67`	Possesses protease activity in vitro.	No verified direct reference in this release
`Os04g0448500`	Anther-specific aspartic protease involved in tapetal programmed cell death (PCD).	EAT1 promotes tapetal cell death by regulating aspartic proteases during male reproductive development in rice.2013 · DOI: 10.1038/ncomms2396

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013590 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009555 pollen development Biological Process

GO:0009846 pollen germination Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0030163 protein catabolic process Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G49050

ath:AT1G65240

ath:AT5G36260

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.487

Rank 1 · TkA02G391730 · TK1151

Extracellular0.206

Rank 2 · TkA02G391730 · TK1151

Endoplasmic reticulum0.112

Rank 3 · TkA02G391730 · TK1151

Cytoplasm0.100

Rank 4 · TkA02G391730 · TK1151

Lysosome / Vacuole0.079

Rank 5 · TkA02G391730 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14543TAXi_N99-263 aa

PF00026Asp99-439 aa

PF13975gag-asp_proteas110-139 aa

PF14541TAXi_C286-439 aa

PF13975gag-asp_proteas313-334 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G391730	`PF14543`	TAXi_N	99	263	1.2e-37	130.5
TkA02G391730	`PF00026`	Asp	99	439	9.1e-34	118.0
TkA02G391730	`PF13975`	gag-asp_proteas	110	139	0.14	13.5
TkA02G391730	`PF14541`	TAXi_C	286	439	1.9e-28	100.0
TkA02G391730	`PF13975`	gag-asp_proteas	313	334	0.14	13.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q4V3D2`	Arabidopsis thaliana	sp\|Q4V3D2\|ASP36_ARATH Aspartic proteinase 36	34.200%	Swiss-Prot	Medium
`O04496`	Arabidopsis thaliana	sp\|O04496\|AED3_ARATH Aspartyl protease AED3	25.500%	Swiss-Prot	Low
`A2ZC67`	Oryza sativa subsp. indica	sp\|A2ZC67\|ASP1_ORYSI Aspartic proteinase Asp1	27.000%	Swiss-Prot	Low
`Q7XV21`	Oryza sativa subsp. japonica	sp\|Q7XV21\|AP37_ORYSJ Aspartyl protease 37	24.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card