TkA02G386810 | RubberDandelionOmics

Gene overview

TkA02G386810

Reference: TK1151 Chr: Chr02 Coordinates: 98291430-98294702 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

918 bp · TkA02G386810|TK1151|cDNA

ATGACAAGAATACAAGAGATGTCGCTTAACTACCACTTCAAAGTGGAGCAAGAAGTTGGTTCATCAACTTATGCATTCTTTGGCTTCAATGGAACTGCAGGAGTTTGGCGAATGACGACACTTAACGATGTTGGAGGATGGAATGATCGCACCACAGTCGAAGACATGGATTTGGCGGTCAGAGCTAGTCTTGCAGGATGGAAGTTCTTGTACCTGGCTCGGTCAAAGGTTAAAAACGAATTGCCAAGTACATTGAAAGC...

CDS

Download CDS FASTA

918 bp · TkA02G386810|TK1151|CDS

ATGACAAGAATACAAGAGATGTCGCTTAACTACCACTTCAAAGTGGAGCAAGAAGTTGGTTCATCAACTTATGCATTCTTTGGCTTCAATGGAACTGCAGGAGTTTGGCGAATGACGACACTTAACGATGTTGGAGGATGGAATGATCGCACCACAGTCGAAGACATGGATTTGGCGGTCAGAGCTAGTCTTGCAGGATGGAAGTTCTTGTACCTGGCTCGGTCAAAGGTTAAAAACGAATTGCCAAGTACATTGAAAGC...

Protein

Download Protein FASTA

305 aa · TkA02G386810|TK1151|PROTEIN

MTRIQEMSLNYHFKVEQEVGSSTYAFFGFNGTAGVWRMTTLNDVGGWNDRTTVEDMDLAVRASLAGWKFLYLARSKVKNELPSTLKAYRYQQHRWSCGAANLFKKMAYEIIINERVIFWKKLHVIYSFFFVRKIVAHIVTFTLYCIVIPACVWVPEVEVPIWTIVYVPTIITILNVTRTPRSLYLVVFWIVFENVMSLHRSKATLIGLFEAKRVNEWVVTEKLGDASKDTNITRRHGMINFKLSERYLDSFRLLVLELSI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G386810`
TK1151 ID	TkA02G386810
OH-1004 ID	LXL04_014884
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	69.000
Protein coverage (%)	TK1151 99.672 / OH-1004 18.935 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G386810

Location Chr02:98291430-98294702 (-)

Description Similar to RE1: Retrovirus-related Pol polyprotein from transposon RE1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g03760`	Possesses glucomannan synthase and mannan synthase activities in vitro.	Agrobacterium-mediated root transformation is inhibited by mutation of an Arabidopsis cellulose synthase-like gene.2003 · DOI: 10.1104/pp.103.030726
`At5g22740`	Possesses glucomannan synthase and mannan synthase activities in vitro.	No verified direct reference in this release
`At1g23480`	Probable mannan synthase which consists of a 4-beta-mannosyltransferase activity on mannan using GDP-mannose.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0625700`	Probable mannan synthase which consists of a 4-beta-mannosyltransferase activity on mannan using GDP-mannose.	No verified direct reference in this release
`Os02g0192500`	Possesses glucomannan synthase and mannan synthase activities in vitro.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014884 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006310 DNA recombination Biological Process

GO:0006508 proteolysis Biological Process

GO:0015074 DNA integration Biological Process

GO:0003676 nucleic acid binding Molecular Function

GO:0003964 RNA-directed DNA polymerase activity Molecular Function

GO:0004190 aspartic-type endopeptidase activity Molecular Function

GO:0004519 endonuclease activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.435

Rank 1 · TkA02G386810 · TK1151

Golgi apparatus0.240

Rank 2 · TkA02G386810 · TK1151

Cell membrane0.124

Rank 3 · TkA02G386810 · TK1151

Cytoplasm0.105

Rank 4 · TkA02G386810 · TK1151

Nucleus0.084

Rank 5 · TkA02G386810 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13632Glyco_trans_2_311-153 aa

PF13506Glyco_transf_2129-142 aa

PF13641Glyco_tranf_2_330-98 aa

PF13632Glyco_trans_2_3270-288 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G386810	`PF13632`	Glyco_trans_2_3	11	153	1.1e-15	58.6
TkA02G386810	`PF13506`	Glyco_transf_21	29	142	0.015	14.9
TkA02G386810	`PF13641`	Glyco_tranf_2_3	30	98	8.1e-08	33.0
TkA02G386810	`PF13632`	Glyco_trans_2_3	270	288	1.1e-15	58.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZR3`	Arabidopsis thaliana	sp\|Q9LZR3\|CSLA9_ARATH Glucomannan 4-beta-mannosyltransferase 9	65.800%	Swiss-Prot	High
`Q9FNI7`	Arabidopsis thaliana	sp\|Q9FNI7\|CSLA2_ARATH Glucomannan 4-beta-mannosyltransferase 2	64.300%	Swiss-Prot	High
`Q9LQC9`	Arabidopsis thaliana	sp\|Q9LQC9\|CSLA3_ARATH Probable glucomannan 4-beta-mannosyltransferase 3	62.600%	Swiss-Prot	High
`Q67VS7`	Oryza sativa subsp. japonica	sp\|Q67VS7\|CSLA9_ORYSJ Probable glucomannan 4-beta-mannosyltransferase 9	63.200%	Swiss-Prot	High
`Q7PC76`	Oryza sativa subsp. japonica	sp\|Q7PC76\|CSLA1_ORYSJ Glucomannan 4-beta-mannosyltransferase 1	63.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card