TkA02G384070 | RubberDandelionOmics

Gene overview

TkA02G384070

Reference: TK1151 Chr: Chr02 Coordinates: 97608834-97609400 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

567 bp · TkA02G384070|TK1151|cDNA

ATGAAGAAGAATTCAACTCAAATATCTCAAAAACCTTCCCTCACCGATCTCGGCTTTACGGGAAACTTCATTCAAGTAACCGCCTTAGAACCAAAAGTGGTACTAAAAGCCATACATGACCTGGATTTTGTGGGGAAGGTCAGAGGACAAGGCTACTACTTTAAAATACCCTCTCGCGCCAAATGTAATTGTAGCTATATTGAAGAGTATGATCAAGTTTTATTGAGGGAGAAATTTATTACTCGTTCACTTGACAACGA...

CDS

Download CDS FASTA

567 bp · TkA02G384070|TK1151|CDS

ATGAAGAAGAATTCAACTCAAATATCTCAAAAACCTTCCCTCACCGATCTCGGCTTTACGGGAAACTTCATTCAAGTAACCGCCTTAGAACCAAAAGTGGTACTAAAAGCCATACATGACCTGGATTTTGTGGGGAAGGTCAGAGGACAAGGCTACTACTTTAAAATACCCTCTCGCGCCAAATGTAATTGTAGCTATATTGAAGAGTATGATCAAGTTTTATTGAGGGAGAAATTTATTACTCGTTCACTTGACAACGA...

Protein

Download Protein FASTA

188 aa · TkA02G384070|TK1151|PROTEIN

MKKNSTQISQKPSLTDLGFTGNFIQVTALEPKVVLKAIHDLDFVGKVRGQGYYFKIPSRAKCNCSYIEEYDQVLLREKFITRSLDNESTNSKALMTSCVLSIVVTALKEKVALTKCDVFYMNTTLFEKQYNSDFVIEDVACLLKCTRGSLSIMASERGTVIGNLVFSKDEQIFDCTKQGNGGKQSQEI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G384070`
TK1151 ID	TkA02G384070
OH-1004 ID	LXL04_014917
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	91.400
Protein coverage (%)	TK1151 98.936 / OH-1004 58.307 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G384070

Location Chr02:97608834-97609400 (+)

Description Similar to TOP6A: DNA topoisomerase 6 subunit A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g02820`	Component of the DNA topoisomerase VI involved in chromatin organization and progression of endoreduplication cycles.	A crucial role for the putative Arabidopsis topoisomerase VI in plant growth and development.2002 · DOI: 10.1073/pnas.152337599 DNA topoisomerase VI is essential for endoreduplication in Arabidopsis.2002 · DOI: 10.1016/s0960-9822(02)01198-3

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XFC1`	Component of the DNA topoisomerase VI involved in chromatin organization and progression of endoreduplication cycles.	No verified direct reference in this release
`Os03g0284800`	Component of the DNA topoisomerase VI involved in chromatin organization and progression of endoreduplication cycles.	No verified direct reference in this release
`Os12g0622500`	Required for meiotic recombination.	OsSpo11-4, a rice homologue of the archaeal TopVIA protein, mediates double-strand DNA cleavage and interacts with OsTopVIB.2011 · DOI: 10.1371/journal.pone.0020327

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014917 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000706 meiotic DNA double-strand break processing Biological Process

GO:0006260 DNA replication Biological Process

GO:0006265 DNA topological change Biological Process

GO:0006302 double-strand break repair Biological Process

GO:0007131 reciprocal meiotic recombination Biological Process

GO:0042138 meiotic DNA double-strand break formation Biological Process

GO:0090628 plant epidermal cell fate specification Biological Process

GO:0000228 nuclear chromosome Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005694 chromosome Cellular Component

GO:0009330 DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) complex Cellular Component

GO:0000287 magnesium ion binding Molecular Function

KEGG gene cross-reference

ath:AT5G02820

dosa:Os03g0284800

dosa:Os12g0622500

osa:4332468

pfu:PF1578

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.460

Rank 1 · TkA02G384070 · TK1151

Nucleus0.388

Rank 2 · TkA02G384070 · TK1151

Mitochondrion0.137

Rank 3 · TkA02G384070 · TK1151

Cell membrane0.065

Rank 4 · TkA02G384070 · TK1151

Endoplasmic reticulum0.052

Rank 5 · TkA02G384070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04406TP6A_N93-152 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G384070	`PF04406`	TP6A_N	93	152	2.3e-13	50.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZ03`	Arabidopsis thaliana	sp\|Q9LZ03\|TOP6A_ARATH DNA topoisomerase 6 subunit A	40.000%	Swiss-Prot	Medium
`A2XFC1`	Oryza sativa subsp. indica	sp\|A2XFC1\|TOP6A_ORYSI DNA topoisomerase 6 subunit A3	39.900%	Swiss-Prot	Medium
`Q0DSV9`	Oryza sativa subsp. japonica	sp\|Q0DSV9\|TOP6A_ORYSJ Topoisomerase 6 subunit A3	39.900%	Swiss-Prot	Medium
`Q2QM00`	Oryza sativa subsp. japonica	sp\|Q2QM00\|SPO14_ORYSJ Meiotic recombination protein SPO11-4	35.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card