Gene Card
Gene overview
cDNA / CDS / Protein Sequences
cDNA
No cDNA sequence is available for this reference.
3045 bp · TkA02G383720|TK1151|CDS
ATGATGGATTCAGAGTTCGAATTTGAACCTCCAAGTGATGAGGAATATGACCATGAAGATCTCAACAGTGATGAAGAGAACGATGATGAAACCAGCGATGTAGAAGAAAAAGGAAAAAACCAAAACACAAAAACACAATCTCCATGGGACTTTTCTTCATACACTGAATCAGTTGCAGATGAACATGCCCGCAGAAGCACAACCTCCATTGATGAAAAAATCTCAAGGTTCATCCAACAGCGAAATAATCTTTCAGAATC...
Protein
Download Protein FASTA1014 aa · TkA02G383720|TK1151|PROTEIN
MMDSEFEFEPPSDEEYDHEDLNSDEENDDETSDVEEKGKNQNTKTQSPWDFSSYTESVADEHARRSTTSIDEKISRFIQQRNNLSESIPEKDNEDEGEDEDEDEDGSTDSEPDRQEDFKPEEDDEIPTTEGSKDNKQFFSKADGVSFHANAFMDLHLSRPLLRACEALGYTKPTPIQAACIPLALTGRDICGSAITGSGKTAAFTLPTLERLLFRPKHSPAIRVLILAPTRELAVQIHSMIGKLAQFITDIRCCLVLGGV...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G383720 |
|---|---|
| TK1151 ID | TkA02G383720 |
| OH-1004 ID | LXL04_014924 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 99.900 |
| Protein coverage (%) | TK1151 73.471 / OH-1004 99.866Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G383720 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:97512290-97520854 (-) | ||||||||||||
| Description | Similar to RH28: DEAD-box ATP-dependent RNA helicase 28 | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0010467 gene expression Biological Process GO:0042254 ribosome biogenesis Biological Process GO:0005634 nucleus Cellular Component GO:0005730 nucleolus Cellular Component GO:0005829 cytosol Cellular Component GO:0003723 RNA binding Molecular Function GO:0003724 RNA helicase activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0016887 ATP hydrolysis activity Molecular Function | ||||||||||||
| KEGG gene cross-reference | ath:AT4G16630 cim:CIMG_03301 dosa:Os12g0481100 mgr:MGG_07718 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00270DEAD174-344 aaPF00271Helicase_C209-270 aaPF13401AAA_22283-327 aaPF00271Helicase_C322-389 aaPF00271Helicase_C386-484 aaPF00270DEAD406-454 aaPF13401AAA_22498-538 aaPF00270DEAD517-550 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G383720 | PF00270 | DEAD | 174 | 344 | 3.4e-46 | 157.7 |
| TkA02G383720 | PF00271 | Helicase_C | 209 | 270 | 3.4e-24 | 85.9 |
| TkA02G383720 | PF13401 | AAA_22 | 283 | 327 | 0.083 | 13.9 |
| TkA02G383720 | PF00271 | Helicase_C | 322 | 389 | 3.4e-24 | 85.9 |
| TkA02G383720 | PF00271 | Helicase_C | 386 | 484 | 3.4e-24 | 85.9 |
| TkA02G383720 | PF00270 | DEAD | 406 | 454 | 3.4e-46 | 157.7 |
| TkA02G383720 | PF13401 | AAA_22 | 498 | 538 | 0.083 | 13.9 |
| TkA02G383720 | PF00270 | DEAD | 517 | 550 | 3.4e-46 | 157.7 |
| TkA02G383720 | PF23269 | DUF7074 | 798 | 862 | 2e-23 | 83.1 |
| TkA02G383720 | PF23272 | DUF7075 | 911 | 1001 | 3.2e-26 | 92.9 |
| TkA02G383720 | PF23269 | DUF7074 | 966 | 977 | 2e-23 | 83.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.