TkA02G381670 | RubberDandelionOmics

Gene overview

TkA02G381670

Reference: TK1151 Chr: Chr02 Coordinates: 97036049-97038342 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1144 bp · TkA02G381670|TK1151|cDNA

CTCAAAACCTCTAACTTTATTTACGTGAAGAAAGTTTCAATCTATTTGTTTAAGCCATTAATTTGCTTATGGAAATGGCTTCCAAGAAACGTTTGTCCAAGAATCTGTAAAAAGAAAAAGCGAAAGAGATGATGATTCAAAGACATACCACTTTGAATCTGAAGACAGACTCATAACATATAAAAAAATTCAGTATATAAGTGAGATCAGATCGTCAGTTGTTTTGGCCGGAGATTATTATTTATATAAATGGCGCCAGC...

CDS

Download CDS FASTA

699 bp · TkA02G381670|TK1151|CDS

ATGGCGCCAGCGGGATTGCCTCCAGGTTTTAGGTTCCATCCGACAGATGAAGAGCTTGTGAATTACTATCTTAAAAGGAAGATACATGGCCTAGAGATTGAACTTGACATCATCCCTGAAGTTGATCTCTACAAATGTGAACCATGGGAGTTAGCAGAGAAGTCCTTTCTTCCAAGTAGAGATCCCGAATGGTACTTTTTTGGACCACGGGACCGAAAATATCCAAATGGGTTCAGGACAAACAGGGCAACAAGGGCGGG...

Protein

Download Protein FASTA

232 aa · TkA02G381670|TK1151|PROTEIN

MAPAGLPPGFRFHPTDEELVNYYLKRKIHGLEIELDIIPEVDLYKCEPWELAEKSFLPSRDPEWYFFGPRDRKYPNGFRTNRATRAGYWKSTGKDRRVTSQAQNHAIGMKKTLVYYRGRAPQGIRTDWVMHEYRLDDKDCQDTLGIQDSYALCRVFKKNGVCGEIEDNGHTSMSISQYSPTITNDYETMSPDVPIASTSCLDHEDDKDDSWMQFITDDPWCSPNSPHVTLTN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G381670`
TK1151 ID	TkA02G381670
OH-1004 ID	LXL04_013953
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	53.200
Protein coverage (%)	TK1151 100.000 / OH-1004 38.272 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G381670

Location Chr02:97036049-97038342 (+)

Description Similar to NAC086: NAC domain-containing protein 86

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g03200`	Transcription factor directing sieve element enucleation and cytosol degradation.	No verified direct reference in this release
`At5g17260`	Transcription factor directing sieve element enucleation and cytosol degradation.	No verified direct reference in this release
`At5g46590`	Transcriptional activator involved in the positive regulation of abscisic acid (ABA) responsive genes.	No verified direct reference in this release
`At4g17980`	Transcription factor involved in tissue reunion of wounded inflorescence stems.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0119966`	Transcription factor that functions as a regulator of the jasmonate (JA) signaling pathway.	Disruption of a novel gene for a NAC-domain protein in rice confers resistance to Rice dwarf virus.2009 · DOI: 10.1111/j.1365-313x.2008.03712.x The NAC transcription factor RIM1 of rice is a new regulator of jasmonate signaling.2010 · DOI: 10.1111/j.1365-313x.2009.04107.x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013953 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009611 response to wounding Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0051301 cell division Biological Process

GO:0071365 cellular response to auxin stimulus Biological Process

GO:0090602 sieve element enucleation Biological Process

GO:0090603 sieve element differentiation Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT3G03200

ath:AT4G17980

ath:AT5G17260

ath:AT5G46590

dosa:Os03g0119966

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.861

Rank 1 · TkA02G381670 · TK1151

Cytoplasm0.184

Rank 2 · TkA02G381670 · TK1151

Cell membrane0.064

Rank 3 · TkA02G381670 · TK1151

Endoplasmic reticulum0.062

Rank 4 · TkA02G381670 · TK1151

Plastid0.022

Rank 5 · TkA02G381670 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02365NAM7-135 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G381670	`PF02365`	NAM	7	135	2.1e-49	167.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A4VCM0`	Arabidopsis thaliana	sp\|A4VCM0\|NAC45_ARATH NAC domain-containing protein 45	64.200%	Swiss-Prot	High
`Q9FFI5`	Arabidopsis thaliana	sp\|Q9FFI5\|NAC86_ARATH NAC domain-containing protein 86	54.300%	Swiss-Prot	High
`Q9LS24`	Arabidopsis thaliana	sp\|Q9LS24\|NAC96_ARATH NAC domain-containing protein 96	63.000%	Swiss-Prot	Medium
`O49697`	Arabidopsis thaliana	sp\|O49697\|NAC71_ARATH NAC domain-containing protein 71	64.000%	Swiss-Prot	Medium
`Q8H045`	Oryza sativa subsp. japonica	sp\|Q8H045\|NAC54_ORYSJ NAC domain-containing protein 54	56.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card