TkA02G381530 | RubberDandelionOmics

Gene overview

TkA02G381530

Reference: TK1151 Chr: Chr02 Coordinates: 97002045-97014522 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2695 bp · TkA02G381530|TK1151|cDNA

TAGTGATTCCAAAATCCAAAGAAATACGGTTGGTATGTAGCGATGGTCAAAACTCGAATGTTTTCGTAGAAATTGCCTCTTACTCGCTGCCAAACTTCCCACCCACTTGATCAAACTCAATTTCAACTTGCAAGCCAGATACAAATGCCCTAAATCTACGTTCAATCAATGCATTCCTGTCCAAATCTTTGTGTTCTCTTATAGTTCGCCTGTTTCTAATCATCCTCTTATTTCAACACACTTAATCATCCTCTTATACT...

CDS

Download CDS FASTA

1926 bp · TkA02G381530|TK1151|CDS

ATGGAGACTGTTGGAGAAGATGATGTACACGAGTATAATAGTCCGAAGGCGAAGTCTTCAGAAAAGAGCAAAAGTGTTTCGATATCCATCCCAGTGAGCTCCACGCCTGAATTCTTGTTACCTTCTCAGAATGATGGTGGTGAACAGGGGTGGCTACGACAAAAGAAATTGTTACATGAAGTTTTTAAAATTGGGGTTATGAATCCACATAAAAGTTATGTTAAGCGGTTGAACCAATTCGTTCTCATTTCTTGCTTATG...

Protein

Download Protein FASTA

641 aa · TkA02G381530|TK1151|PROTEIN

METVGEDDVHEYNSPKAKSSEKSKSVSISIPVSSTPEFLLPSQNDGGEQGWLRQKKLLHEVFKIGVMNPHKSYVKRLNQFVLISCLCAIFIDPLFFYLLSVNKEFKCVVINWPMAIILVVSRSITDLIYFLRMLIEFRLAYISPESRVVGDGDLVKRPKKIALHYLSGFFFLDLLIVLPIPQIIVLFIQPNGPTSLGGNSAKFLLQNVIIAQYVPRLYRFLRLLAGQTPNGFMFEAAWANFVVNLWTFVLAGHAIGSIWY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G381530`
TK1151 ID	TkA02G381530
OH-1004 ID	LXL04_014952
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	77.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G381530

Location Chr02:97002045-97014522 (+)

Description Similar to CNGC20: Probable cyclic nucleotide-gated ion channel 20, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g17700`	Probable cyclic nucleotide-gated ion channel.	No verified direct reference in this release
`At3g17690`	Putative cyclic nucleotide-gated ion channel.	No verified direct reference in this release
`At4g30560`	Putative cyclic nucleotide-gated ion channel.	No verified direct reference in this release
`At1g01340`	Probable cyclic nucleotide-gated ion channel.	No verified direct reference in this release
`At2g23980`	Probable cyclic nucleotide-gated ion channel.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014952 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009408 response to heat Biological Process

GO:0009624 response to nematode Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0033198 response to ATP Biological Process

GO:0080027 response to herbivore Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0035618 root hair Cellular Component

GO:0071944 cell periphery Cellular Component

GO:0005216 monoatomic ion channel activity Molecular Function

GO:0005223 intracellularly cGMP-activated cation channel activity Molecular Function

KEGG gene cross-reference

ath:AT1G19780

ath:AT2G23980

ath:AT3G17690

ath:AT3G17700

ath:AT4G30560

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.890

Rank 1 · TkA02G381530 · TK1151

Cytoplasm0.080

Rank 2 · TkA02G381530 · TK1151

Endoplasmic reticulum0.057

Rank 3 · TkA02G381530 · TK1151

Nucleus0.027

Rank 4 · TkA02G381530 · TK1151

Lysosome / Vacuole0.026

Rank 5 · TkA02G381530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00520Ion_trans78-398 aa

PF28500PBP_middle416-453 aa

PF00027cNMP_binding495-581 aa

PF28500PBP_middle606-630 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G381530	`PF00520`	Ion_trans	78	398	9.8e-14	51.8
TkA02G381530	`PF28500`	PBP_middle	416	453	0.38	11.8
TkA02G381530	`PF00027`	cNMP_binding	495	581	0.018	15.7
TkA02G381530	`PF28500`	PBP_middle	606	630	0.38	11.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LD37`	Arabidopsis thaliana	sp\|Q9LD37\|CNG20_ARATH Probable cyclic nucleotide-gated ion channel 20, chloroplastic	57.100%	Swiss-Prot	High
`Q9LDR2`	Arabidopsis thaliana	sp\|Q9LDR2\|CNG19_ARATH Putative cyclic nucleotide-gated ion channel 19	54.500%	Swiss-Prot	High
`Q9M0A4`	Arabidopsis thaliana	sp\|Q9M0A4\|CNGC9_ARATH Putative cyclic nucleotide-gated ion channel 9	40.000%	Swiss-Prot	Medium
`Q9LNJ0`	Arabidopsis thaliana	sp\|Q9LNJ0\|CNG10_ARATH Probable cyclic nucleotide-gated ion channel 10	38.300%	Swiss-Prot	Medium
`O82226`	Arabidopsis thaliana	sp\|O82226\|CNGC6_ARATH Probable cyclic nucleotide-gated ion channel 6	39.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card