RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G380650
Reference: TK1151 Chr: Chr02 Coordinates: 96765663-96772121 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

512 bp · TkA02G380650|TK1151|cDNA

TACACATTGAGTCGACTCAGTTGAGTCGGGGGAAGGGAAGAAACTAGGGACGTAGTTGTCATTTTCCTTAGACCTACCGCAGCTTTAAGTAGGAGAGAGAGATTGTGGGGGAATTTACTAAGAAAGAGGAAAAGATAAAAACAACTGTTTGAGCTGCCATAATGGTGAGGAAGAAGAGGACTGAAACTTCAGGGGAGGGCTCTCAGCCTCAGGAGTTTGCTTCTGGACAAGGTAGTGGTGCTCAAAGGCCGCCACCTCAG...

CDS

Download CDS FASTA

3264 bp · TkA02G380650|TK1151|CDS

ATGGTGAGGAAGAAGAGGACTGAAACTTCAGGGGAGGGCTCTCAGCCTCAGGAGTTTGCTTCTGGACAAGGTAGTGGTGCTCAAAGGCCGCCACCTCAGCAACAACAGCAGGGTGGTGGTGGTGGTTACCAGGGAAGAGGACAGGGTGGTTATCAAGGCAGAGGGCAGGGTGGTGGTTATCAAGGAGGACAAGGACAAGGCGGTGGTTACCAAGGTGGTTACCAAGGCGGACCACCTCAAGGTGGTGGTGGTTACCAAGG...

Protein

Download Protein FASTA

1087 aa · TkA02G380650|TK1151|PROTEIN

MVRKKRTETSGEGSQPQEFASGQGSGAQRPPPQQQQQGGGGGYQGRGQGGYQGRGQGGGYQGGQGQGGGYQGGYQGGPPQGGGGYQGGQQPQGGRGWVQRGGPPPQRGGPPQQYYGGPPDQGQQQRPPRGTAPPQRRGGPSRPSVPELYQATQTPQQPVATLQPTPHADVHHGESSSMSSTDQMADESAAQFQQLSVQQEEPLPIQAPPASSKSMRFPQRPGKGSTGIRCIVKANHFFAELPDKDLHQYDVTITPEVTSR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G380650
TK1151 IDTkA02G380650
OH-1004 IDLXL04_014961
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)97.600
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G380650
LocationChr02:96765663-96772121 (+)
DescriptionSimilar to AGO1B: Protein argonaute 1B
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g48410 Involved in RNA-mediated post-transcriptional gene silencing (PTGS).
Arabidopsis ARGONAUTE1 is an RNA Slicer that selectively recruits microRNAs and short interfering RNAs.2005 · DOI: 10.1073/pnas.0505461102
Cucumber mosaic virus-encoded 2b suppressor inhibits Arabidopsis Argonaute1 cleavage activity to counter plant defense.2006 · DOI: 10.1101/gad.1495506
Sorting of small RNAs into Arabidopsis argonaute complexes is directed by the 5' terminal nucleotide.2008 · DOI: 10.1016/j.cell.2008.02.034
Arabidopsis DRB4, AGO1, AGO7, and RDR6 participate in a DCL4-initiated antiviral RNA silencing pathway negatively regulated by DCL1.2008 · DOI: 10.1073/pnas.0805760105
Redundant and specific roles of the ARGONAUTE proteins AGO1 and ZLL in development and small RNA-directed gene silencing.2009 · DOI: 10.1371/journal.pgen.1000646
The Arabidopsis thaliana double-stranded RNA binding protein DRB1 directs guide strand selection from microRNA duplexes.2009 · DOI: 10.1261/rna.1646909
Unique functionality of 22-nt miRNAs in triggering RDR6-dependent siRNA biogenesis from target transcripts in Arabidopsis.2010 · DOI: 10.1038/nsmb.1866
AGO1 defines a novel locus of Arabidopsis controlling leaf development.1998 · DOI: 10.1093/emboj/17.1.170

Rice

Reference gene IDPossible functionPapers / DOI
Os04g0566500 Involved in the RNA silencing pathway, especially during antiviral responses. No verified direct reference in this release
Os02g0672200 Involved in the RNA silencing pathway, especially during antiviral responses. No verified direct reference in this release
Os02g0831600 Involved in the RNA silencing pathway, especially during antiviral responses. No verified direct reference in this release
Os06g0729300 Probably involved in the RNA silencing pathway. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_014961 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0009616 RNAi-mediated antiviral immune response Biological Process
GO:0009733 response to auxin Biological Process
GO:0009753 response to jasmonic acid Biological Process
GO:0009850 auxin metabolic process Biological Process
GO:0009955 adaxial/abaxial pattern specification Biological Process
GO:0009965 leaf morphogenesis Biological Process
GO:0010218 response to far red light Biological Process
GO:0010267 ta-siRNA processing Biological Process
GO:0010305 leaf vascular tissue pattern formation Biological Process
GO:0010589 leaf proximal/distal pattern formation Biological Process
GO:0016441 post-transcriptional gene silencing Biological Process
KEGG gene cross-reference
ath:AT1G48410
dosa:Os02g0672200
dosa:Os02g0831600
dosa:Os06g0729300
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.725
Rank 1 · TkA02G380650 · TK1151
Nucleus0.381
Rank 2 · TkA02G380650 · TK1151
Cell membrane0.079
Rank 3 · TkA02G380650 · TK1151
Endoplasmic reticulum0.065
Rank 4 · TkA02G380650 · TK1151
Mitochondrion0.057
Rank 5 · TkA02G380650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12764Gly-rich_Ago150-82 aa
PF12764Gly-rich_Ago196-201 aa
PF16486ArgoN230-363 aa
PF08699ArgoL1373-423 aa
PF02170PAZ429-555 aa
PF16488ArgoL2565-611 aa
PF16487ArgoMid622-696 aa
PF02171Piwi716-1035 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G380650PF12764Gly-rich_Ago150821.6e-0732.7
TkA02G380650PF12764Gly-rich_Ago1962011.6e-0732.7
TkA02G380650PF16486ArgoN2303634.7e-37128.3
TkA02G380650PF08699ArgoL13734235e-2278.0
TkA02G380650PF02170PAZ4295554.8e-30104.8
TkA02G380650PF16488ArgoL25656111.3e-1661.3
TkA02G380650PF16487ArgoMid6226964.6e-1246.7
TkA02G380650PF02171Piwi71610351.7e-115386.2
TkA02G380650PF12764Gly-rich_Ago17738131.6e-0732.7
TkA02G380650PF12764Gly-rich_Ago1105210761.6e-0732.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
O04379Arabidopsis thalianasp|O04379|AGO1_ARATH Protein argonaute 181.200%Swiss-ProtHigh
Q7XSA2Oryza sativa subsp. japonicasp|Q7XSA2|AGO1B_ORYSJ Protein argonaute 1B79.800%Swiss-ProtHigh
Q6EU14Oryza sativa subsp. japonicasp|Q6EU14|AGO1A_ORYSJ Protein argonaute 1A79.300%Swiss-ProtHigh
Q6K972Oryza sativa subsp. japonicasp|Q6K972|AGO1C_ORYSJ Protein argonaute 1C80.100%Swiss-ProtHigh
Q5Z5B2Oryza sativa subsp. japonicasp|Q5Z5B2|AGO1D_ORYSJ Protein argonaute 1D75.900%Swiss-ProtHigh

JBrowse

View in Genome Browser