TkA02G380470 | RubberDandelionOmics

Gene overview

TkA02G380470

Reference: TK1151 Chr: Chr02 Coordinates: 96721016-96721882 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

372 bp · TkA02G380470|TK1151|cDNA

ATGGCCGCTCCACCAGCAAGAGCACGAGTAGATTATGATTACCTCATAAAGCTCCTCTTGATTGGTGACAGCGCTGGAAGAATACGATTAGTGTTCTCATGCTACAGGAAAGTCAACTTTCATGAAGCATCTACGCTTTGCTGCTTTAATTTTTTTTCTTTCCTGGCCTGTGTGGGAAAGAGTTGCCTTTTTTTGCGATTTTCTGATGGATCTTTCACTACAAGTTTCATCACTACCATCAGTATTGATTTTAAGATAAG...

CDS

Download CDS FASTA

372 bp · TkA02G380470|TK1151|CDS

ATGGCCGCTCCACCAGCAAGAGCACGAGTAGATTATGATTACCTCATAAAGCTCCTCTTGATTGGTGACAGCGCTGGAAGAATACGATTAGTGTTCTCATGCTACAGGAAAGTCAACTTTCATGAAGCATCTACGCTTTGCTGCTTTAATTTTTTTTCTTTCCTGGCCTGTGTGGGAAAGAGTTGCCTTTTTTTGCGATTTTCTGATGGATCTTTCACTACAAGTTTCATCACTACCATCAGTATTGATTTTAAGATAAG...

Protein

Download Protein FASTA

123 aa · TkA02G380470|TK1151|PROTEIN

MAAPPARARVDYDYLIKLLLIGDSAGRIRLVFSCYRKVNFHEASTLCCFNFFSFLACVGKSCLFLRFSDGSFTTSFITTISIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTDLGKVLLLP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G380470`
TK1151 ID	TkA02G380470
OH-1004 ID	LXL04_014966
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G380470

Location Chr02:96721016-96721882 (+)

Description Similar to RABE1A: Ras-related protein RABE1a

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g53610`	Involved in membrane trafficking from the Golgi to the plasma membrane.	No verified direct reference in this release
`At3g46060`	Involved in membrane trafficking from the Golgi to the plasma membrane.	No verified direct reference in this release
`At5g03520`	Involved in membrane trafficking from the Golgi to the plasma membrane.	No verified direct reference in this release
`At3g09900`	Involved in membrane trafficking from the Golgi to the plasma membrane.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014966 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006887 exocytosis Biological Process

GO:0006971 hypotonic response Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0015031 protein transport Biological Process

GO:0016339 calcium-dependent cell-cell adhesion Biological Process

GO:0030036 actin cytoskeleton organization Biological Process

GO:0033298 contractile vacuole organization Biological Process

GO:0050708 regulation of protein secretion Biological Process

GO:0051600 regulation of endocytosis by exocyst localization Biological Process

GO:0070177 contractile vacuole discharge Biological Process

GO:0140025 contractile vacuole tethering involved in discharge Biological Process

KEGG gene cross-reference

ath:AT3G46060

ath:AT3G53610

bvg:104900163

ddi:DDB_G0276399

ddi:DDB_G0280043

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.427

Rank 1 · TkA02G380470 · TK1151

Nucleus0.223

Rank 2 · TkA02G380470 · TK1151

Endoplasmic reticulum0.196

Rank 3 · TkA02G380470 · TK1151

Mitochondrion0.147

Rank 4 · TkA02G380470 · TK1151

Golgi apparatus0.135

Rank 5 · TkA02G380470 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00071Ras17-43 aa

PF08477Roc17-25 aa

PF00025Arf55-111 aa

PF00071Ras57-114 aa

PF08477Roc57-113 aa

PF01926MMR_HSR158-107 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G380470	`PF00071`	Ras	17	43	5.8e-22	78.7
TkA02G380470	`PF08477`	Roc	17	25	1.3e-14	55.2
TkA02G380470	`PF00025`	Arf	55	111	0.00087	19.5
TkA02G380470	`PF00071`	Ras	57	114	5.8e-22	78.7
TkA02G380470	`PF08477`	Roc	57	113	1.3e-14	55.2
TkA02G380470	`PF01926`	MMR_HSR1	58	107	0.095	13.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O24466`	Arabidopsis thaliana	sp\|O24466\|RAE1A_ARATH Ras-related protein RABE1a	68.400%	Swiss-Prot	High
`P28186`	Arabidopsis thaliana	sp\|P28186\|RAE1C_ARATH Ras-related protein RABE1c	68.400%	Swiss-Prot	High
`Q9LZD4`	Arabidopsis thaliana	sp\|Q9LZD4\|RAE1D_ARATH Ras-related protein RABE1d	64.000%	Swiss-Prot	High
`Q9SF91`	Arabidopsis thaliana	sp\|Q9SF91\|RAE1E_ARATH Ras-related protein RABE1e	64.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card