TkA02G380420 | RubberDandelionOmics

Gene overview

TkA02G380420

Reference: TK1151 Chr: Chr02 Coordinates: 96696469-96700867 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1621 bp · TkA02G380420|TK1151|cDNA

ATAATCTCAATATTTGGCATTTCCATACTATGTTAATATAAATAACCAAAATTCAATACAAGACTGAGCAAATTACTTCATTGTCGGCCGGTAAAAGATGAGCAAGAACGGAGTTGGAAGGTCTGCACTGCAACAGCAGTCCAAATTGTGGGCACTTGGGCTTGTGTTGCTGTCCATCTGTACTCTTTCCTTCTCAGAGATCATCTTCGAGGAGCGATTCGACGATGGGTGGCAGAGCCGGTGGGTAAAGTCCGACTGGA...

CDS

Download CDS FASTA

1305 bp · TkA02G380420|TK1151|CDS

ATGAGCAAGAACGGAGTTGGAAGGTCTGCACTGCAACAGCAGTCCAAATTGTGGGCACTTGGGCTTGTGTTGCTGTCCATCTGTACTCTTTCCTTCTCAGAGATCATCTTCGAGGAGCGATTCGACGATGGGTGGCAGAGCCGGTGGGTAAAGTCCGACTGGAAAAAAAGTGAAGGAAAAGCCGGTACATTTAAGCACACAGCAGGGTCGTGGTCCGGTGATCCAGATGATAAAGGCATTCAGACATCAGTTGACGCCAG...

Protein

Download Protein FASTA

434 aa · TkA02G380420|TK1151|PROTEIN

MSKNGVGRSALQQQSKLWALGLVLLSICTLSFSEIIFEERFDDGWQSRWVKSDWKKSEGKAGTFKHTAGSWSGDPDDKGIQTSVDARHNAISAKIPEFNNKNRTLVLQYSIKFEQDIECGGGYIKLMSGYVNQKKFGGDTPYSIMFGPDLCGTQTKKLHVIVSYQGQNYPIKKDLQCETDKLTHFYTFVLRPDASYSILIDGRERDSGSLYTDWDILPPRKIKAVNAKKPADWEDREYIEDPNQVKPEGYDSIPREIPDP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G380420`
TK1151 ID	TkA02G380420
OH-1004 ID	LXL04_014971
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G380420

Location Chr02:96696469-96700867 (-)

Description Similar to CRT3: Calreticulin-3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g08450`	Molecular calcium-binding chaperone promoting folding, oligomeric assembly and quality control in the ER via the calreticulin/calnexin cycle.	Specific ER quality control components required for biogenesis of the plant innate immune receptor EFR.2009 · DOI: 10.1073/pnas.0905532106 Receptor quality control in the endoplasmic reticulum for plant innate immunity.2009 · DOI: 10.1038/emboj.2009.263
`At1g56340`	Molecular calcium-binding chaperone promoting folding, oligomeric assembly and quality control in the ER via the calreticulin/calnexin cycle.	No verified direct reference in this release
`At1g09210`	Molecular calcium-binding chaperone promoting folding, oligomeric assembly and quality control in the ER via the calreticulin/calnexin cycle.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014971 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0034976 response to endoplasmic reticulum stress Biological Process

GO:0036503 ERAD pathway Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0046283 anthocyanin-containing compound metabolic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005788 endoplasmic reticulum lumen Cellular Component

KEGG gene cross-reference

ath:AT1G08450

ath:AT1G09210

ath:AT1G56340

rcu:8269812

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.647

Rank 1 · TkA02G380420 · TK1151

Cytoplasm0.156

Rank 2 · TkA02G380420 · TK1151

Extracellular0.155

Rank 3 · TkA02G380420 · TK1151

Lysosome / Vacuole0.115

Rank 4 · TkA02G380420 · TK1151

Golgi apparatus0.100

Rank 5 · TkA02G380420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00262Calreticulin37-273 aa

PF00262Calreticulin274-347 aa

PF30567DUF8634336-358 aa

PF02724CDC45343-419 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G380420	`PF00262`	Calreticulin	37	273	1e-76	259.0
TkA02G380420	`PF00262`	Calreticulin	274	347	1e-76	259.0
TkA02G380420	`PF30567`	DUF8634	336	358	0.2	12.1
TkA02G380420	`PF02724`	CDC45	343	419	4.3	6.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04153`	Arabidopsis thaliana	sp\|O04153\|CALR3_ARATH Calreticulin-3	75.800%	Swiss-Prot	High
`O04151`	Arabidopsis thaliana	sp\|O04151\|CALR1_ARATH Calreticulin-1	61.800%	Swiss-Prot	High
`Q38858`	Arabidopsis thaliana	sp\|Q38858\|CALR2_ARATH Calreticulin-2	60.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card