TkA02G380070 | RubberDandelionOmics

Gene overview

TkA02G380070

Reference: TK1151 Chr: Chr02 Coordinates: 96605203-96609042 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1110 bp · TkA02G380070|TK1151|cDNA

CACAATTGCAAAAAATGTTAAAATTTCCCACCTTTAAAACCATCGATGCCTCACTCCCTTTGCATTGGTCTTCCTCCTTGCAATTAGCTTCAAAATCTCTTCCAATAACTGCTCAAATCTCTTCCTTCGCTGGTCTTACTCTCCGCCGTCGCTCTTACACCACCATAGCCGTCGCCATGGGTGATGATTCCGGCATGGACGCTGTCCAGAGACGTCTCATGTTTGATGATGAATGCATTTTGGTGGATGAAAATGACAAT...

CDS

Download CDS FASTA

450 bp · TkA02G380070|TK1151|CDS

ATGTTAAAATTTCCCACCTTTAAAACCATCGATGCCTCACTCCCTTTGCATTGGTCTTCCTCCTTGCAATTAGCTTCAAAATCTCTTCCAATAACTGCTCAAATCTCTTCCTTCGCTGGTCTTACTCTCCGCCGTCGCTCTTACACCACCATAGCCGTCGCCATGGGTGATGATTCCGGCATGGACGCTGTCCAGAGACGTCTCATGTTTGATGATGAATGCATTTTGGTGGATGAAAATGACAATGTCGTTGGGCATGA...

Protein

Download Protein FASTA

149 aa · TkA02G380070|TK1151|PROTEIN

MLKFPTFKTIDASLPLHWSSSLQLASKSLPITAQISSFAGLTLRRRSYTTIAVAMGDDSGMDAVQRRLMFDDECILVDENDNVVGHDTKYNCHLMEKIEKENLLHRAFSVFLFNSKYELLLQQRSATKVTFPWYGPTPVAAIHYTENPS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G380070`
TK1151 ID	TkA02G380070
OH-1004 ID	LXL04_014975
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 88.591 / OH-1004 46.154 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G380070

Location Chr02:96605203-96609042 (-)

Description Similar to IPI1: Isopentenyl-diphosphate Delta-isomerase I

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g16440`	Catalyzes the 1,3-allylic rearrangement of the homoallylic substrate isopentenyl (IPP) to its highly electrophilic allylic isomer, dimethylallyl diphosphate (DMAPP).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014975 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009240 isopentenyl diphosphate biosynthetic process Biological Process

GO:0015979 photosynthesis Biological Process

GO:0015995 chlorophyll biosynthetic process Biological Process

GO:0050992 dimethylallyl diphosphate biosynthetic process Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004452 isopentenyl-diphosphate delta-isomerase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.861

Rank 1 · TkA02G380070 · TK1151

Mitochondrion0.142

Rank 2 · TkA02G380070 · TK1151

Nucleus0.024

Rank 3 · TkA02G380070 · TK1151

Cytoplasm0.017

Rank 4 · TkA02G380070 · TK1151

Cell membrane0.007

Rank 5 · TkA02G380070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00293NUDIX104-131 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G380070	`PF00293`	NUDIX	104	131	0.031	15.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q38929`	Arabidopsis thaliana	sp\|Q38929\|IDI1_ARATH Isopentenyl-diphosphate Delta-isomerase I, chloroplastic	81.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card