TkA02G373380 | RubberDandelionOmics

Gene overview

TkA02G373380

Reference: TK1151 Chr: Chr02 Coordinates: 95060580-95060995 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

348 bp · TkA02G373380|TK1151|cDNA

ATGATTACTCACGTTTCGATGGCCCACATCACAAGATCATATGGGTCCCTCATTTCATTGAAGATGGGGTTGTGCACCAATATACCCGCAAAAGCTTTCGTTGTGATTGGGCAAGGTTGTCGCTTTCTTGAGGAGCTTGAGCTTACGGATAATGCACTCGATGACAAAGGCCTGAAGTCCATCTCAAAGTGCTCCCAACTCTCTGCCTTGAAGCTTGCTGCATGCCTAAGTATAAGTGATGAAGGGCTTCTTTTCATTGA...

CDS

Download CDS FASTA

348 bp · TkA02G373380|TK1151|CDS

ATGATTACTCACGTTTCGATGGCCCACATCACAAGATCATATGGGTCCCTCATTTCATTGAAGATGGGGTTGTGCACCAATATACCCGCAAAAGCTTTCGTTGTGATTGGGCAAGGTTGTCGCTTTCTTGAGGAGCTTGAGCTTACGGATAATGCACTCGATGACAAAGGCCTGAAGTCCATCTCAAAGTGCTCCCAACTCTCTGCCTTGAAGCTTGCTGCATGCCTAAGTATAAGTGATGAAGGGCTTCTTTTCATTGA...

Protein

Download Protein FASTA

115 aa · TkA02G373380|TK1151|PROTEIN

MITHVSMAHITRSYGSLISLKMGLCTNIPAKAFVVIGQGCRFLEELELTDNALDDKGLKSISKCSQLSALKLAACLSISDEGLLFIEKTASKFPKNLPNLIIEKNNVTQKYTWKL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G373380`
TK1151 ID	TkA02G373380
OH-1004 ID	LXL04_019225
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	67.100
Protein coverage (%)	TK1151 60.870 / OH-1004 10.370 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G373380

Location Chr02:95060580-95060995 (-)

Description Similar to FBL3: F-box/LRR-repeat protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g01720`	F-box/LRR-repeat protein 3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019225 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006289 nucleotide-excision repair Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0010225 response to UV-C Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0019005 SCF ubiquitin ligase complex Cellular Component

KEGG gene cross-reference

ath:AT4G15475

ath:AT5G01720

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.397

Rank 1 · TkA02G373380 · TK1151

Cytoplasm0.365

Rank 2 · TkA02G373380 · TK1151

Mitochondrion0.095

Rank 3 · TkA02G373380 · TK1151

Cell membrane0.049

Rank 4 · TkA02G373380 · TK1151

Extracellular0.037

Rank 5 · TkA02G373380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25372LRR_FBXL1515-49 aa

PF29594LRR_SKP219-91 aa

PF13855LRR_838-74 aa

PF13516LRR_640-62 aa

PF25372LRR_FBXL1558-88 aa

PF13516LRR_669-84 aa

PF13855LRR_876-108 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G373380	`PF25372`	LRR_FBXL15	15	49	0.00023	20.4
TkA02G373380	`PF29594`	LRR_SKP2	19	91	1.3e-06	28.6
TkA02G373380	`PF13855`	LRR_8	38	74	0.0014	19.1
TkA02G373380	`PF13516`	LRR_6	40	62	2.3e-06	27.9
TkA02G373380	`PF25372`	LRR_FBXL15	58	88	0.00023	20.4
TkA02G373380	`PF13516`	LRR_6	69	84	2.3e-06	27.9
TkA02G373380	`PF13855`	LRR_8	76	108	0.0014	19.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RWU5`	Arabidopsis thaliana	sp\|Q8RWU5\|FBL3_ARATH F-box/LRR-repeat protein 3	65.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card