Gene Card
Gene overview
cDNA / CDS / Protein Sequences
567 bp · TkA02G372790|TK1151|cDNA
ATGTTTACTGCCAGGGTTAGAATTGCTTTGGAAGAAAAGGGCATCAAATATGACTTGCCATACAGCAAAAGCCCTCTTCTTCTCCAACTCAACCCACTTTGCAAAAAAGTCCCGGTTTTTGTTCACAATGGAAGACCCGTTTGTGAGTCCACAATCATAATTGAGTACATCGATGAGTCATGGAAGGATAATGAATCTCCATTGTTGCCTTCTGATCCTTATCTCAGATCTCAAGCTAGGTTTTGGGCTGATTATACTAA...
567 bp · TkA02G372790|TK1151|CDS
ATGTTTACTGCCAGGGTTAGAATTGCTTTGGAAGAAAAGGGCATCAAATATGACTTGCCATACAGCAAAAGCCCTCTTCTTCTCCAACTCAACCCACTTTGCAAAAAAGTCCCGGTTTTTGTTCACAATGGAAGACCCGTTTGTGAGTCCACAATCATAATTGAGTACATCGATGAGTCATGGAAGGATAATGAATCTCCATTGTTGCCTTCTGATCCTTATCTCAGATCTCAAGCTAGGTTTTGGGCTGATTATACTAA...
Protein
Download Protein FASTA188 aa · TkA02G372790|TK1151|PROTEIN
MFTARVRIALEEKGIKYDLPYSKSPLLLQLNPLCKKVPVFVHNGRPVCESTIIIEYIDESWKDNESPLLPSDPYLRSQARFWADYTNKIYEFGIKLVMGSKGEEMEKASQELLGCLKVLEGELDNEKSFFFMGEVFGYVDIAFVAFYSHLCTYEILGNFSLKNDCPNSKVVCLGCKMHAKGECFQDSC
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G372790 |
|---|---|
| TK1151 ID | TkA02G372790 |
| OH-1004 ID | LXL04_015042 |
| Relationship / confidence | Multi Candidate From Tk1151 / Complex relationship |
| Protein identity (%) | 84.600 |
| Protein coverage (%) | TK1151 79.255 / OH-1004 53.455Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G372790 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:94858562-94859206 (-) | |||||||||
| Description | Similar to Probable glutathione S-transferase | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006749 glutathione metabolic process Biological Process GO:0006979 response to oxidative stress Biological Process GO:0009407 toxin catabolic process Biological Process GO:0009734 auxin-activated signaling pathway Biological Process GO:0042631 cellular response to water deprivation Biological Process GO:0046256 2,4,6-trinitrotoluene catabolic process Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G17180 ath:AT1G78380 nta:107772524 nta:107782951 nta:107823949 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF02798GST_N2-59 aaPF13409GST_N_22-59 aaPF13417GST_N_32-59 aaPF22041GST_C_791-147 aaPF00043GST_C101-150 aaPF13410GST_C_2105-146 aaPF13417GST_N_3164-176 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G372790 | PF02798 | GST_N | 2 | 59 | 3.8e-14 | 53.5 |
| TkA02G372790 | PF13409 | GST_N_2 | 2 | 59 | 1.9e-13 | 51.6 |
| TkA02G372790 | PF13417 | GST_N_3 | 2 | 59 | 5.3e-12 | 46.6 |
| TkA02G372790 | PF22041 | GST_C_7 | 91 | 147 | 0.0044 | 17.7 |
| TkA02G372790 | PF00043 | GST_C | 101 | 150 | 0.00026 | 21.9 |
| TkA02G372790 | PF13410 | GST_C_2 | 105 | 146 | 0.03 | 15.1 |
| TkA02G372790 | PF13417 | GST_N_3 | 164 | 176 | 5.3e-12 | 46.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.