TkA02G369660 | RubberDandelionOmics

Gene overview

TkA02G369660

Reference: TK1151 Chr: Chr02 Coordinates: 94068404-94072656 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3326 bp · TkA02G369660|TK1151|cDNA

CTCGTCAGAGATTCTTCCAATTTTTTCTATACCTATAGTATAAGATATCTACTCACAGTCTATACTCTATATTAATCGTACTACCGCCATCATCTGTTCTATGCCTTCCTTCACCTCAGTCTCCAACGACTGAACAATGAAGATGAAGCTCCTTCTTCTTCTTCACATTCTCCTTTTCACCCTTCTGGATTTATCAAATGGATCTTCAGATCTTGATGCACTCCTGAAGCTCAAAGCATCAATGGCTGTGGCACCAGACA...

CDS

Download CDS FASTA

2922 bp · TkA02G369660|TK1151|CDS

ATGAAGATGAAGCTCCTTCTTCTTCTTCACATTCTCCTTTTCACCCTTCTGGATTTATCAAATGGATCTTCAGATCTTGATGCACTCCTGAAGCTCAAAGCATCAATGGCTGTGGCACCAGACAGGTCTGTCTTAGATGATTGGGTACCTAATTCAATCGTCTACAATTCACATTGTTCGTTTTCTGGAGTTACGTGTGATGAGAACTCACGTGTAACGTCGTTGATAATCTCGAATGTTGCTCTGAACGGTAGTATTCC...

Protein

Download Protein FASTA

973 aa · TkA02G369660|TK1151|PROTEIN

MKMKLLLLLHILLFTLLDLSNGSSDLDALLKLKASMAVAPDRSVLDDWVPNSIVYNSHCSFSGVTCDENSRVTSLIISNVALNGSIPPEIGILNKLVNITLTSDGLTGELPLEMCNLTSIRFINFSTNAFTGEFPGEIVAAMTELEVFDVYNNNFSGKLPLEFVKLKNLKTLFLGGNFFNGEIPEEYSEFQSLRSLGLQGNELSGRIPWRLSRLSTLEELWLGYYNSYDGGIPPEFGSFKALKLLDAGGCNLTGEIPESL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G369660`
TK1151 ID	TkA02G369660
OH-1004 ID	LXL04_015092
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G369660

Location Chr02:94068404-94072656 (+)

Description Similar to CLV1: Receptor protein kinase CLAVATA1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g75820`	LRR-rich receptor-like kinase (LRR-RLK) that, similarly to BAM1 and BAM3, participates in the detection of CLAVATA-family peptides (e.g. CLV3, CLE25, CLE26 and CLE45), and to the regulation of the triggered signaling required for protophloem differentiation and meristems maintenance through the phosphorylation of CIK proteins (CIKs) and of PBL34, PBL35 and PBL36.	Stem cell signaling in Arabidopsis requires CRN to localize CLV2 to the plasma membrane.2010 · DOI: 10.1104/pp.109.149930 Receptor-like cytoplasmic kinase MAZZA mediates developmental processes with CLAVATA1 family receptors in Arabidopsis.2021 · DOI: 10.1093/jxb/erab183 A CLE-BAM-CIK signalling module controls root protophloem differentiation in Arabidopsis.2022 · DOI: 10.1111/nph.17791 Receptor-like cytoplasmic kinases PBL34/35/36 are required for CLE peptide-mediated signaling to maintain shoot apical meristem and root apical meristem homeostasis in Arabidopsis.2022 · DOI: 10.1093/plcell/koab315

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015092 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007172 signal complex assembly Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0009934 regulation of meristem structural organization Biological Process

GO:0030154 cell differentiation Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0036289 peptidyl-serine autophosphorylation Biological Process

GO:2000037 regulation of stomatal complex patterning Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G75820

gmx:732625

gmx:732661

mtr:11439632

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.868

Rank 1 · TkA02G369660 · TK1151

Endoplasmic reticulum0.087

Rank 2 · TkA02G369660 · TK1151

Cytoplasm0.062

Rank 3 · TkA02G369660 · TK1151

Nucleus0.037

Rank 4 · TkA02G369660 · TK1151

Lysosome / Vacuole0.029

Rank 5 · TkA02G369660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_224-67 aa

PF25013LRR_Zer-164-97 aa

PF12799LRR_471-103 aa

PF00560LRR_172-91 aa

PF13855LRR_872-128 aa

PF25019LRR_R13L1-DRL2183-124 aa

PF23598LRR_1485-151 aa

PF23211LRR_LRWD187-134 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G369660	`PF08263`	LRRNT_2	24	67	1.8e-07	32.0
TkA02G369660	`PF25013`	LRR_Zer-1	64	97	0.00016	22.6
TkA02G369660	`PF12799`	LRR_4	71	103	1.9e-33	114.4
TkA02G369660	`PF00560`	LRR_1	72	91	3.2e-47	149.0
TkA02G369660	`PF13855`	LRR_8	72	128	5.7e-31	106.8
TkA02G369660	`PF25019`	LRR_R13L1-DRL21	83	124	0.00042	20.9
TkA02G369660	`PF23598`	LRR_14	85	151	1.7e-34	119.9
TkA02G369660	`PF23211`	LRR_LRWD1	87	134	5.5	7.4
TkA02G369660	`PF00560`	LRR_1	96	117	3.2e-47	149.0
TkA02G369660	`PF24141`	LRR_ComC	106	187	1.4e-10	42.0
TkA02G369660	`PF12799`	LRR_4	111	128	1.9e-33	114.4
TkA02G369660	`PF00560`	LRR_1	119	138	3.2e-47	149.0
TkA02G369660	`PF25019`	LRR_R13L1-DRL21	133	174	0.00042	20.9
TkA02G369660	`PF25013`	LRR_Zer-1	139	172	0.00016	22.6
TkA02G369660	`PF12799`	LRR_4	143	179	1.9e-33	114.4
TkA02G369660	`PF24758`	LRR_At5g56370	143	203	8.3e-10	39.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SYQ8`	Arabidopsis thaliana	sp\|Q9SYQ8\|CLV1_ARATH Receptor protein kinase CLAVATA1	69.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card