TkA02G367150 | RubberDandelionOmics

Gene overview

TkA02G367150

Reference: TK1151 Chr: Chr02 Coordinates: 93388097-93392334 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3118 bp · TkA02G367150|TK1151|cDNA

AAAAGAAAGAAGTATAAAATGTAAACAAATAAAAGAAAAGGGGCCTGCTATGCTATGTCTTCTCTTCATTCTTTTCACTCCCGCTTCTCTCTCTTCGGAATACACCGAAATTCGCTCTCGTTCAACAAACCCTAAATCAGACAGCTGAGAGAGACGTGTAAGGTTGCAGTCTCCATCTCGAATAGCTCAAACGTGAATCGCAAACTAATTTTCAGCTCTGCTGGCGATTAATTGTCATATTCACTCTGTATAATCTTATT...

CDS

Download CDS FASTA

2337 bp · TkA02G367150|TK1151|CDS

ATGGAGAGTCCAGAAGTGTTGTTGGACACAAAGATGGCTTTTCATAGTACTGATGGAGTTAATGATATGAATGGCCATACTTCATGTGGTAATGGATCCAAACCCATACAAGCTGACATAGTTATTGAAGACAGTGACCCTTTAGATGTTTTAGAAGATCTGGATACGATGATGGAAGACATTATTGATAACCGCCTGAAAATTGCACGATTGGTGAGTGATTCTGTGATGAAGGGAATGGTCAGTGCTGTTGAAGAAGA...

Protein

Download Protein FASTA

778 aa · TkA02G367150|TK1151|PROTEIN

MESPEVLLDTKMAFHSTDGVNDMNGHTSCGNGSKPIQADIVIEDSDPLDVLEDLDTMMEDIIDNRLKIARLVSDSVMKGMVSAVEEEAEEKIKAKDLELAVLKMSLQYHNVNGDQNKSWWLQETLEDASVNHDNLKESLIVLKKSATDQFKKLRKQIEGVRGCKIKRNGSCHEIVGLGGILKEEKYENGVDLEKTIDNLEMVMNSTYGLVNTMLISSKTSLSEWQQEHELKRELEDMVMQTSIRCIWDQNASCCGRQSVD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G367150`
TK1151 ID	TkA02G367150
OH-1004 ID	LXL04_015115
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.800
Protein coverage (%)	TK1151 97.301 / OH-1004 90.876 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G367150

Location Chr02:93388097-93392334 (-)

Description Similar to WAP: WPP domain-associated protein (Fragment)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g34730`	WPP domain-associated protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015115 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT2G34730

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.535

Rank 1 · TkA02G367150 · TK1151

Nucleus0.303

Rank 2 · TkA02G367150 · TK1151

Cell membrane0.120

Rank 3 · TkA02G367150 · TK1151

Golgi apparatus0.114

Rank 4 · TkA02G367150 · TK1151

Endoplasmic reticulum0.066

Rank 5 · TkA02G367150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08350FilR1_middle52-110 aa

PF25771CC_CEP152-bind228-240 aa

PF25771CC_CEP152-bind346-365 aa

PF08350FilR1_middle465-510 aa

PF25771CC_CEP152-bind489-503 aa

PF08350FilR1_middle559-584 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G367150	`PF08350`	FilR1_middle	52	110	0.32	11.8
TkA02G367150	`PF25771`	CC_CEP152-bind	228	240	0.51	10.6
TkA02G367150	`PF25771`	CC_CEP152-bind	346	365	0.51	10.6
TkA02G367150	`PF08350`	FilR1_middle	465	510	0.32	11.8
TkA02G367150	`PF25771`	CC_CEP152-bind	489	503	0.51	10.6
TkA02G367150	`PF08350`	FilR1_middle	559	584	0.32	11.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64584`	Arabidopsis thaliana	sp\|O64584\|WAP_ARATH WPP domain-associated protein	30.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card