TkA02G363570 | RubberDandelionOmics

Gene overview

TkA02G363570

Reference: TK1151 Chr: Chr02 Coordinates: 92488089-92496927 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1277 bp · TkA02G363570|TK1151|cDNA

ATGATTTTTTTAGTTGCTAAGGTCATCATCTTGTTTGTATGTGCTTCTCTTCATTCATGCAACAGCGAAGGAAGAACAAATTTGCCAGAAATCGTCTCTGTACCCGCACTCATAACATTTGGAGACTCCTTTGTCGATCAAGGGAATAATAACTACATCGCCGCTTTGGGCAAGGCAAATCATCCCCCATATGGGAAAGATTTTGTTGGTGGAAATGCAACCGGAAGGTTCTCCAATGGAAAAACACTCGCTGACTTTTT...

CDS

Download CDS FASTA

1071 bp · TkA02G363570|TK1151|CDS

ATGATTTTTTTAGTTGCTAAGGTCATCATCTTGTTTGTATGTGCTTCTCTTCATTCATGCAACAGCGAAGGAAGAACAAATTTGCCAGAAATCGTCTCTGTACCCGCACTCATAACATTTGGAGACTCCTTTGTCGATCAAGGGAATAATAACTACATCGCCGCTTTGGGCAAGGCAAATCATCCCCCATATGGGAAAGATTTTGTTGGTGGAAATGCAACCGGAAGGTTCTCCAATGGAAAAACACTCGCTGACTTTTT...

Protein

Download Protein FASTA

356 aa · TkA02G363570|TK1151|PROTEIN

MIFLVAKVIILFVCASLHSCNSEGRTNLPEIVSVPALITFGDSFVDQGNNNYIAALGKANHPPYGKDFVGGNATGRFSNGKTLADFFAEGLGVKEYLQAYLDPSIQDNDLLSGVSFASGGSGYDPVTPKISLAIPLSDQLDLFKQYIGRLEMNVGQEEATKIITNSVFLVVASTNDLMVAYPIIRRSEYDVPAYNSILLNLTLSFVQELYELGARKIGVFGAPPVGCFPAERTLFGGLPERMCVDDRNEAAQLYNSMLEE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G363570`
TK1151 ID	TkA02G363570
OH-1004 ID	LXL04_015131
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	98.900
Protein coverage (%)	TK1151 76.404 / OH-1004 92.517 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G363570

Location Chr02:92488089-92496927 (-)

Description Similar to EXL3: GDSL esterase/lipase EXL3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q9FHW9`	GDSL esterase/lipase At5g42170.	No verified direct reference in this release
`At1g75900`	GDSL esterase/lipase EXL3.	No verified direct reference in this release
`At3g14820`	GDSL esterase/lipase At3g14820.	No verified direct reference in this release
`At1g58725`	GDSL esterase/lipase At1g58725.	No verified direct reference in this release
`At1g59030`	GDSL esterase/lipase At1g59030.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015131 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016042 lipid catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0016298 lipase activity Molecular Function

GO:0016746 acyltransferase activity Molecular Function

GO:0016788 hydrolase activity, acting on ester bonds Molecular Function

KEGG gene cross-reference

ath:AT1G58725

ath:AT1G59030

ath:AT1G59406

ath:AT1G75900

ath:AT3G14820

ath:AT5G42170

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.308

Rank 1 · TkA02G363570 · TK1151

Lysosome / Vacuole0.263

Rank 2 · TkA02G363570 · TK1151

Endoplasmic reticulum0.152

Rank 3 · TkA02G363570 · TK1151

Cytoplasm0.138

Rank 4 · TkA02G363570 · TK1151

Cell membrane0.042

Rank 5 · TkA02G363570 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF19040SGNH33-59 aa

PF00657Lipase_GDSL38-342 aa

PF19040SGNH312-341 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G363570	`PF19040`	SGNH	33	59	0.44	10.9
TkA02G363570	`PF00657`	Lipase_GDSL	38	342	1.2e-27	98.2
TkA02G363570	`PF19040`	SGNH	312	341	0.44	10.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FHW9`	Arabidopsis thaliana	sp\|Q9FHW9\|GDL90_ARATH GDSL esterase/lipase At5g42170	48.200%	Swiss-Prot	Medium
`Q94CH6`	Arabidopsis thaliana	sp\|Q94CH6\|EXL3_ARATH GDSL esterase/lipase EXL3	47.000%	Swiss-Prot	Medium
`Q9LH73`	Arabidopsis thaliana	sp\|Q9LH73\|GDL52_ARATH GDSL esterase/lipase At3g14820	48.600%	Swiss-Prot	Medium
`Q3ECM4`	Arabidopsis thaliana	sp\|Q3ECM4\|GDL25_ARATH GDSL esterase/lipase At1g58725	45.500%	Swiss-Prot	Medium
`F4IBF0`	Arabidopsis thaliana	sp\|F4IBF0\|GDL26_ARATH GDSL esterase/lipase At1g59030	45.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card