TkA02G362420 | RubberDandelionOmics

Gene overview

TkA02G362420

Reference: TK1151 Chr: Chr02 Coordinates: 92180336-92188892 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1502 bp · TkA02G362420|TK1151|cDNA

GTAAGATCGGTCCTTCGCCCTGCCCAAGTGTTTGATAAATTGCTTGTGGGAGTTGGTAGTTTTGTTCGTAAATCTTCGACAGCGCCCTTGTAGCAACTAATAGCTGTCTCGACGCTTCCCATTCTTCTTGTAATCGGCGGTGTCTTCAGTCTTCAACCCACCCACCATTTACGGAACCCTAGAGCTAAACCAATCAGATGAAAGCTCAACGGCAGACTCTAGACAGAATTAGCGCTCTCCCTCAAGACACAATTGAAAAG...

CDS

Download CDS FASTA

1176 bp · TkA02G362420|TK1151|CDS

ATGAAAGCTCAACGGCAGACTCTAGACAGAATTAGCGCTCTCCCTCAAGACACAATTGAAAAGATTCTGACTCTGATGCCAATCCGAGATGCATTAAGGACAAGCATACTGTCAAGGAGATGGAGGTATTCTTGGAGGACCATTCCGAAACTTGCCTTTGATGACAACGAGATTGTAGAATCTGATCACAACCAGAGTGTACACTCAGATTACTGTGAAATCGATAATTATAAGTTTGTTAAAGCCATCTTCCACGTTTT...

Protein

Download Protein FASTA

391 aa · TkA02G362420|TK1151|PROTEIN

MKAQRQTLDRISALPQDTIEKILTLMPIRDALRTSILSRRWRYSWRTIPKLAFDDNEIVESDHNQSVHSDYCEIDNYKFVKAIFHVLLLHRAPILEFSLSSTEKNICSEIDQIILHLSSSNNVKKIVLKIWVTDGYQLPGSFYSLQGLEHIDLTYCTFEPPLMNTGFSMLKRLHFWRCPVTSKTLLGFLTKSPLLEQFTWTGHSGTYIELTESELVEMFKCLPSVQVFEISMLHIKHLVAGSMPHKLPISLPHLKILDLG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G362420`
TK1151 ID	TkA02G362420
OH-1004 ID	LXL04_015139
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.900
Protein coverage (%)	TK1151 99.744 / OH-1004 34.767 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G362420

Location Chr02:92180336-92188892 (-)

Description Similar to At1g13570: F-box/FBD/LRR-repeat protein At1g13570

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g13570`	F-box/FBD/LRR-repeat protein At1g13570.	No verified direct reference in this release
`At5g56370`	FBD-associated F-box protein At5g56370.	No verified direct reference in this release
`At5g56440`	Putative FBD-associated F-box protein At5g56440.	No verified direct reference in this release
`At4g00160`	F-box/FBD/LRR-repeat protein At4g00160.	No verified direct reference in this release
`At3g03360`	F-box/LRR-repeat protein At3g03360.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015139 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G13570

ath:AT5G56370

ath:AT5G56440

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.786

Rank 1 · TkA02G362420 · TK1151

Cytoplasm0.295

Rank 2 · TkA02G362420 · TK1151

Endoplasmic reticulum0.045

Rank 3 · TkA02G362420 · TK1151

Cell membrane0.045

Rank 4 · TkA02G362420 · TK1151

Plastid0.018

Rank 5 · TkA02G362420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box11-48 aa

PF12937F-box-like11-42 aa

PF23622LRR_At1g61320_AtMIF1108-200 aa

PF24758LRR_At5g56370115-212 aa

PF12799LRR_4115-156 aa

PF13855LRR_8139-155 aa

PF28313DUF8380163-232 aa

PF00646F-box167-185 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G362420	`PF00646`	F-box	11	48	5.9e-07	29.9
TkA02G362420	`PF12937`	F-box-like	11	42	0.028	14.9
TkA02G362420	`PF23622`	LRR_At1g61320_AtMIF1	108	200	5e-13	49.9
TkA02G362420	`PF24758`	LRR_At5g56370	115	212	1.3e-09	38.8
TkA02G362420	`PF12799`	LRR_4	115	156	0.28	12.2
TkA02G362420	`PF13855`	LRR_8	139	155	0.11	13.0
TkA02G362420	`PF28313`	DUF8380	163	232	0.068	12.8
TkA02G362420	`PF00646`	F-box	167	185	5.9e-07	29.9
TkA02G362420	`PF12799`	LRR_4	170	182	0.28	12.2
TkA02G362420	`PF08387`	FBD	195	207	0.00025	21.6
TkA02G362420	`PF24758`	LRR_At5g56370	223	288	1.3e-09	38.8
TkA02G362420	`PF13855`	LRR_8	247	259	0.11	13.0
TkA02G362420	`PF13855`	LRR_8	247	266	0.11	13.0
TkA02G362420	`PF23622`	LRR_At1g61320_AtMIF1	249	352	5e-13	49.9
TkA02G362420	`PF12799`	LRR_4	249	261	0.28	12.2
TkA02G362420	`PF12799`	LRR_4	252	285	0.28	12.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FZ70`	Arabidopsis thaliana	sp\|Q9FZ70\|FDL1_ARATH F-box/FBD/LRR-repeat protein At1g13570	29.900%	Swiss-Prot	Low
`Q9FM94`	Arabidopsis thaliana	sp\|Q9FM94\|FBD21_ARATH FBD-associated F-box protein At5g56370	25.400%	Swiss-Prot	Low
`Q9FM87`	Arabidopsis thaliana	sp\|Q9FM87\|FBD26_ARATH Putative FBD-associated F-box protein At5g56440	28.400%	Swiss-Prot	Low
`Q8LF09`	Arabidopsis thaliana	sp\|Q8LF09\|FDL23_ARATH F-box/FBD/LRR-repeat protein At4g00160	28.200%	Swiss-Prot	Low
`Q84W80`	Arabidopsis thaliana	sp\|Q84W80\|FBL42_ARATH F-box/LRR-repeat protein At3g03360	29.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card