Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3440 bp · TkA02G360820|TK1151|cDNA
TTAACATAAAAATATTGAGTCAACTCAGTCGTTCTGTTGCTATCAACCTCCACCATCCATTAGTGAACATCCACACATCACTTGTGCACCATTAGACAAAAACTATACTATAGTCCCTCCAAGAATCATGCCTAAGAGGGGACTTCAACAGTAACACCACCACAAATATATATAAATACTGTTTCACTATATAGCCAAAAACACAATAGAGATATATATTATATATATATATATATATATATATTACCTTTACGCCCCTG...
1809 bp · TkA02G360820|TK1151|CDS
ATGTTCTTTCAAATAAAAATCTCCTTCTTCTTCTTTGTGTGGTTTGTACATGTGAGTCTTCAAGATTCCATTCGAACAGATAAAGAAGCTCTTCTTGAATTCAAGAAAAGTATAAAAATAGACCCGAATTCAGTACTTTCAAATTGGAATGAAAGTAATGAAGTTTGTAGTTTCAGAGGGATTTATTGCAAGAATGGTTACCGTGTAAGGAGAATCAAGCTTGTTGGATTTGGACTTGTGGGCCCGCTTCCATCTTCTAT...
Protein
Download Protein FASTA602 aa · TkA02G360820|TK1151|PROTEIN
MFFQIKISFFFFVWFVHVSLQDSIRTDKEALLEFKKSIKIDPNSVLSNWNESNEVCSFRGIYCKNGYRVRRIKLVGFGLVGPLPSSISNLTALRTIDLSGNNFYGKIPDGISSLIHFRYLLLESNNLEGRIPESLSSLSNLTILSLKDNKLQGEIPPSLFSNCTVLSNLDLSHNFLNGKIPENIGNCPNLWTLNLYNNRFIGEIPFSLSNASDMYNLDVESNYLSGELPSKLVSKLTKLLYLHLSYNYMVSHDQNNNLDV...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G360820 |
|---|---|
| TK1151 ID | TkA02G360820 |
| OH-1004 ID | LXL04_031994 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 88.800 |
| Protein coverage (%) | TK1151 99.336 / OH-1004 61.294Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G360820 |
|---|---|
| Location | Chr02:91728841-91732656 (-) |
| Description | Similar to At2g24130: Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g24130 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0002237 response to molecule of bacterial origin Biological Process GO:0002764 immune response-regulating signaling pathway Biological Process GO:0006952 defense response Biological Process GO:0009617 response to bacterium Biological Process GO:0009626 plant-type hypersensitive response Biological Process GO:0009755 hormone-mediated signaling pathway Biological Process GO:0016045 detection of bacterium Biological Process GO:0140426 pathogen-associated molecular pattern receptor signaling pathway Biological Process GO:0005634 nucleus Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005886 plasma membrane Cellular Component GO:0012505 endomembrane system Cellular Component |
| KEGG gene cross-reference | ath:AT2G24130 ath:AT3G47570 ath:AT5G20480 osa:107276510 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF08263LRRNT_226-63 aaPF00560LRR_178-90 aaPF24758LRR_At5g5637082-124 aaPF25019LRR_R13L1-DRL2183-123 aaPF13855LRR_885-127 aaPF23598LRR_1485-191 aaPF12799LRR_486-108 aaPF00560LRR_193-114 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G360820 | PF08263 | LRRNT_2 | 26 | 63 | 8.6e-12 | 45.9 |
| TkA02G360820 | PF00560 | LRR_1 | 78 | 90 | 5.9e-44 | 139.3 |
| TkA02G360820 | PF24758 | LRR_At5g56370 | 82 | 124 | 0.0031 | 17.9 |
| TkA02G360820 | PF25019 | LRR_R13L1-DRL21 | 83 | 123 | 0.08 | 13.6 |
| TkA02G360820 | PF13855 | LRR_8 | 85 | 127 | 4.3e-31 | 107.2 |
| TkA02G360820 | PF23598 | LRR_14 | 85 | 191 | 3.4e-23 | 82.7 |
| TkA02G360820 | PF12799 | LRR_4 | 86 | 108 | 6.5e-23 | 81.0 |
| TkA02G360820 | PF00560 | LRR_1 | 93 | 114 | 5.9e-44 | 139.3 |
| TkA02G360820 | PF13516 | LRR_6 | 93 | 102 | 0.55 | 11.1 |
| TkA02G360820 | PF29594 | LRR_SKP2 | 94 | 146 | 0.21 | 11.5 |
| TkA02G360820 | PF13516 | LRR_6 | 116 | 128 | 0.55 | 11.1 |
| TkA02G360820 | PF00560 | LRR_1 | 117 | 138 | 5.9e-44 | 139.3 |
| TkA02G360820 | PF24758 | LRR_At5g56370 | 117 | 174 | 0.0031 | 17.9 |
| TkA02G360820 | PF13855 | LRR_8 | 118 | 174 | 4.3e-31 | 107.2 |
| TkA02G360820 | PF12799 | LRR_4 | 118 | 151 | 6.5e-23 | 81.0 |
| TkA02G360820 | PF25019 | LRR_R13L1-DRL21 | 127 | 195 | 0.08 | 13.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.