TkA02G356550 | RubberDandelionOmics

Gene overview

TkA02G356550

Reference: TK1151 Chr: Chr02 Coordinates: 90566954-90567696 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

609 bp · TkA02G356550|TK1151|cDNA

ATGAACTTACTAGCTTGTTTGTTCAATGGTCTTCACAACCCAACACTCATAAACATTGTGGGTGACGGAGAAGAGACCATTATAATACCTAAGGTGAAGTTTTTGTCTTTGAGTGAGCTACCAAGTCTTTTGGGCTTGTGCCATAATGTCAATAAAATTGAGCTACCTCAACTTGTGGAGCTGAAACTTGCCAACATTCCAGGTGTTACAAACATTTATTCACATAACAAGTTGGAAACATCTTTGTTTAAGGAAGAGGC...

CDS

Download CDS FASTA

609 bp · TkA02G356550|TK1151|CDS

ATGAACTTACTAGCTTGTTTGTTCAATGGTCTTCACAACCCAACACTCATAAACATTGTGGGTGACGGAGAAGAGACCATTATAATACCTAAGGTGAAGTTTTTGTCTTTGAGTGAGCTACCAAGTCTTTTGGGCTTGTGCCATAATGTCAATAAAATTGAGCTACCTCAACTTGTGGAGCTGAAACTTGCCAACATTCCAGGTGTTACAAACATTTATTCACATAACAAGTTGGAAACATCTTTGTTTAAGGAAGAGGC...

Protein

Download Protein FASTA

202 aa · TkA02G356550|TK1151|PROTEIN

MNLLACLFNGLHNPTLINIVGDGEETIIIPKVKFLSLSELPSLLGLCHNVNKIELPQLVELKLANIPGVTNIYSHNKLETSLFKEEAVLPKLEKMYITDMQNLKEIWTCEFSTTEEVRLKEIQVKSCDNLVNMFPSNSMSFLHNLEELNIEKCGSIEALFNIDLDCVGEFKEGNSTSKLRIIQVKELGKLGGGGGGGMEDKR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G356550`
TK1151 ID	TkA02G356550
OH-1004 ID	LXL04_015203
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.500
Protein coverage (%)	TK1151 98.020 / OH-1004 72.527 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G356550`
Location	Chr02:90566954-90567696 (+)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_015203` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.489

Rank 1 · TkA02G356550 · TK1151

Cytoplasm0.324

Rank 2 · TkA02G356550 · TK1151

Cell membrane0.153

Rank 3 · TkA02G356550 · TK1151

Endoplasmic reticulum0.103

Rank 4 · TkA02G356550 · TK1151

Extracellular0.036

Rank 5 · TkA02G356550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25019LRR_R13L1-DRL2151-100 aa

PF23247LRR_RPS253-76 aa

PF04367DUF50253-135 aa

PF12799LRR_453-66 aa

PF12799LRR_474-99 aa

PF25019LRR_R13L1-DRL2184-106 aa

PF25019LRR_R13L1-DRL2192-153 aa

PF23247LRR_RPS293-190 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G356550	`PF25019`	LRR_R13L1-DRL21	51	100	0.032	14.8
TkA02G356550	`PF23247`	LRR_RPS2	53	76	2.9e-17	63.8
TkA02G356550	`PF04367`	DUF502	53	135	0.027	15.1
TkA02G356550	`PF12799`	LRR_4	53	66	0.11	13.5
TkA02G356550	`PF12799`	LRR_4	74	99	0.11	13.5
TkA02G356550	`PF25019`	LRR_R13L1-DRL21	84	106	0.032	14.8
TkA02G356550	`PF25019`	LRR_R13L1-DRL21	92	153	0.032	14.8
TkA02G356550	`PF23247`	LRR_RPS2	93	190	2.9e-17	63.8
TkA02G356550	`PF25019`	LRR_R13L1-DRL21	118	153	0.032	14.8
TkA02G356550	`PF12799`	LRR_4	137	158	0.11	13.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card