TkA02G355340 | RubberDandelionOmics

Gene overview

TkA02G355340

Reference: TK1151 Chr: Chr02 Coordinates: 90256005-90261570 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3460 bp · TkA02G355340|TK1151|cDNA

ATTGCTTACCCACACACACACCAACATTCAATACTTTAATTTTTCGCCCACTATTAAAGAAATGTCCAAAACCGAGAGAGAAAACCACTTTTTTATTGATTTGGATCTTACATCACCCATTTAACTAGGGATATAATGTTTCCTAGTTTCGTCATCTCAGATCATCTCAAAATTGAATCTTTCGTTCTTTATCTTTCGACCCGAAAGGATCTTCTCTCTCTCTCTAGAGCAAGGTTGACTAGCTGCGGGATTCCCTATGA...

CDS

Download CDS FASTA

2460 bp · TkA02G355340|TK1151|CDS

ATGGACGATAGCGTATTTCCTCCCAATAACATGTTCGAGAATCCCTCCGAATCCTTAATGGACTACGATTACATGGACGAACTTTTACTAGACGGGTGTTGGCTACAAGCAACAGACGGATCCGAATTCATAAACAACAACAGCAACAATAATCCCCTTTTCGATACTCCATTTCTATGGCCCACTTTTGACGACATTCAAGAAAATCAAGAAGGTGGGAATTCATCAAAAACCCTCGTGTGTAATTCCGTCGGATTTCA...

Protein

Download Protein FASTA

819 aa · TkA02G355340|TK1151|PROTEIN

MDDSVFPPNNMFENPSESLMDYDYMDELLLDGCWLQATDGSEFINNNSNNNPLFDTPFLWPTFDDIQENQEGGNSSKTLVCNSVGFHNQSENFQFENPDMSRRWWIPPGIGPSLSVKERLFYAIESIKQSTFQRNMLIQIWLPENQEGKKVLRTSSQLSSLDTNCPQLSYYRNISEGYEFPAEGNSKEIVGLPGRVFMGKVPEWTPDVRFFKTEEYPRVGHAQEFDVKGTVAIPVFDRDSQSCLGVIEVVMTTQKSSYNP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G355340`
TK1151 ID	TkA02G355340
OH-1004 ID	LXL04_015217
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G355340

Location Chr02:90256005-90261570 (-)

Description Similar to NLP4: Protein NLP4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g20640`	Probable transcription factor.	No verified direct reference in this release
`At1g76350`	Probable transcription factor.	No verified direct reference in this release
`At4g35270`	Probable transcription factor.	No verified direct reference in this release
`At2g17150`	Probable transcription factor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0131100`	Probable transcription factor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015217 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0010167 response to nitrate Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000987 cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0001216 DNA-binding transcription activator activity Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G20640

ath:AT1G64530

ath:AT1G76350

ath:AT4G38340

dosa:Os01g0236700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.938

Rank 1 · TkA02G355340 · TK1151

Cytoplasm0.120

Rank 2 · TkA02G355340 · TK1151

Cell membrane0.046

Rank 3 · TkA02G355340 · TK1151

Endoplasmic reticulum0.029

Rank 4 · TkA02G355340 · TK1151

Plastid0.018

Rank 5 · TkA02G355340 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22922GAF_NLP137-254 aa

PF13185GAF_2191-261 aa

PF14215bHLH-MYC_N191-235 aa

PF22922GAF_NLP290-460 aa

PF13185GAF_2356-391 aa

PF14215bHLH-MYC_N361-414 aa

PF02042RWP-RK525-593 aa

PF18024HTH_50526-568 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G355340	`PF22922`	GAF_NLP	137	254	2.6e-90	301.3
TkA02G355340	`PF13185`	GAF_2	191	261	0.029	15.3
TkA02G355340	`PF14215`	bHLH-MYC_N	191	235	0.11	13.5
TkA02G355340	`PF22922`	GAF_NLP	290	460	2.6e-90	301.3
TkA02G355340	`PF13185`	GAF_2	356	391	0.029	15.3
TkA02G355340	`PF14215`	bHLH-MYC_N	361	414	0.11	13.5
TkA02G355340	`PF02042`	RWP-RK	525	593	6.7e-26	91.0
TkA02G355340	`PF18024`	HTH_50	526	568	0.052	14.0
TkA02G355340	`PF12728`	HTH_17	543	570	0.019	15.9
TkA02G355340	`PF00564`	PB1	725	805	4e-19	69.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LE38`	Arabidopsis thaliana	sp\|Q9LE38\|NLP4_ARATH Protein NLP4	47.800%	Swiss-Prot	Medium
`Q9SFW8`	Arabidopsis thaliana	sp\|Q9SFW8\|NLP5_ARATH Protein NLP5	48.400%	Swiss-Prot	Medium
`Q7X9B9`	Arabidopsis thaliana	sp\|Q7X9B9\|NLP2_ARATH Protein NLP2	44.000%	Swiss-Prot	Medium
`Q8H111`	Arabidopsis thaliana	sp\|Q8H111\|NLP1_ARATH Protein NLP1	43.500%	Swiss-Prot	Medium
`Q10S83`	Oryza sativa subsp. japonica	sp\|Q10S83\|NLP1_ORYSJ Protein NLP1	43.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card