Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3116 bp · TkA02G353200|TK1151|cDNA
ACAACCTGTTGAGAGAGAGAGAGAGAGAGAGAGATAAATATATCCAATGGCTGTAGAGGCAGTAGTGTCTGTAGTGTTGCAGAAACTAAGTGACATGCTGAAAGGGGAATCATTAACCCAAAACAAAGTTATAGTGTACGAAGTCCAGGGGATGATGAAGTCGCTCAACTCAATGAGAGGCTTGATCTCCTCCAAGGATATCAATCAGAGAGCAGATGGGTATCTCGAGGCTATTTACAACATGGAGGACAAGATCGAGA...
1818 bp · TkA02G353200|TK1151|CDS
ATGGCTGTAGAGGCAGTAGTGTCTGTAGTGTTGCAGAAACTAAGTGACATGCTGAAAGGGGAATCATTAACCCAAAACAAAGTTATAGTGTACGAAGTCCAGGGGATGATGAAGTCGCTCAACTCAATGAGAGGCTTGATCTCCTCCAAGGATATCAATCAGAGAGCAGATGGGTATCTCGAGGCTATTTACAACATGGAGGACAAGATCGAGAAGTTCACTCTCATTGTTTCTTGCAGGCGGAAGGTATTTGGTGTGTT...
Protein
Download Protein FASTA605 aa · TkA02G353200|TK1151|PROTEIN
MAVEAVVSVVLQKLSDMLKGESLTQNKVIVYEVQGMMKSLNSMRGLISSKDINQRADGYLEAIYNMEDKIEKFTLIVSCRRKVFGVLGNHIFIFNNINSCHKIHHKIKKITVKLMKQRDKTDVGGPKLELLMKQGSFSISETQATTPGGLEELSFNYSCNEEEIQIVGIKQRFQQTRRLSSFSYIEEELGIFGRNEDVDTLVNKLTDINSGHVVSILGQSGIGKTTLARTIYKSKEIKRHFQFRAWVSVLDKYTAKDILQ...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G353200 |
|---|---|
| TK1151 ID | TkA02G353200 |
| OH-1004 ID | LXL04_015236 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 97.500 |
| Protein coverage (%) | TK1151 99.339 / OH-1004 64.141Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G353200 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:89800735-89803951 (+) | |||||||||
| Description | Similar to RPP8L3: Disease resistance RPP8-like protein 3 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006952 defense response Biological Process GO:0009626 plant-type hypersensitive response Biological Process GO:0098542 defense response to other organism Biological Process GO:0005886 plasma membrane Cellular Component GO:0012505 endomembrane system Cellular Component GO:0031234 extrinsic component of cytoplasmic side of plasma membrane Cellular Component GO:0000166 nucleotide binding Molecular Function GO:0005524 ATP binding Molecular Function GO:0043531 ADP binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G53350 ath:AT1G58390 ath:AT1G59780 ath:AT3G07040 ath:AT5G35450 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF18052Rx_N6-81 aaPF00931NB-ARC10-81 aaPF25199nSTAND_NTPase544-82 aaPF20720nSTAND359-97 aaPF23243HEAT_HEATR167-117 aaPF13173AAA_1470-134 aaPF25201nSTAND6191-265 aaPF20703nSTAND1191-230 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G353200 | PF18052 | Rx_N | 6 | 81 | 0.006 | 17.4 |
| TkA02G353200 | PF00931 | NB-ARC | 10 | 81 | 4.2e-32 | 111.8 |
| TkA02G353200 | PF25199 | nSTAND_NTPase5 | 44 | 82 | 0.23 | 12.0 |
| TkA02G353200 | PF20720 | nSTAND3 | 59 | 97 | 0.0006 | 20.2 |
| TkA02G353200 | PF23243 | HEAT_HEATR1 | 67 | 117 | 0.14 | 12.8 |
| TkA02G353200 | PF13173 | AAA_14 | 70 | 134 | 9.1e-05 | 23.2 |
| TkA02G353200 | PF25201 | nSTAND6 | 191 | 265 | 0.00033 | 21.4 |
| TkA02G353200 | PF20703 | nSTAND1 | 191 | 230 | 0.00044 | 20.7 |
| TkA02G353200 | PF13191 | AAA_16 | 192 | 246 | 2.6e-06 | 28.8 |
| TkA02G353200 | PF00158 | Sigma54_activat | 193 | 239 | 0.02 | 15.3 |
| TkA02G353200 | PF00931 | NB-ARC | 195 | 361 | 4.2e-32 | 111.8 |
| TkA02G353200 | PF02367 | TsaE | 196 | 288 | 0.0033 | 18.1 |
| TkA02G353200 | PF25199 | nSTAND_NTPase5 | 198 | 229 | 0.23 | 12.0 |
| TkA02G353200 | PF03193 | RsgA_GTPase | 200 | 237 | 0.00026 | 21.6 |
| TkA02G353200 | PF01637 | ATPase_2 | 202 | 261 | 0.028 | 15.0 |
| TkA02G353200 | PF00006 | ATP-synt_ab | 202 | 235 | 0.093 | 13.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.