Gene Card
Gene overview
cDNA / CDS / Protein Sequences
4039 bp · TkA02G353120|TK1151|cDNA
AAAGTTCCCGCCAAAGAAGTTTATTGAACCCTAAAACCTCAATCAGCTAATTCTACAAGAAAACCGAGAATGAAGGCAAACCACCGGCGAGAATCTCCGTACACCGGGAAGAAGCAATGTCTTCGTACTCACTGCCAGCATCAAACAAACCCTAAATCGTCGAAAAAGAATGTCATTCACATTGGCGGCATACCAATCGAGTTCCTTACCAACCATATGGCTCTCAGCTGGCTTATATGGGGAGAGTAATCGCAACTCTT...
1179 bp · TkA02G353120|TK1151|CDS
ATGATGGAGGGCCTTATTAGTTGGATTGGGCGGAAGAAAAATTCATTGGGGAAGCATAGTTTTCAACATACTGCATCATGCTGGACTGCTAATAAAGCTTTAAGAGAACTTCAAGAAGCAAGCATATCAAAGCAGTGCTTTCCAATCTTACAAGAGTGTGCCACAAAGGCAATCAAGATTGCTACAGAGGCAGATCCAGAAGTTGACCATCTAAGTGGCATGCCCTGTACTGTATTAGAAGGCCTTTTCTCTTCGCTTAC...
Protein
Download Protein FASTA392 aa · TkA02G353120|TK1151|PROTEIN
MMEGLISWIGRKKNSLGKHSFQHTASCWTANKALRELQEASISKQCFPILQECATKAIKIATEADPEVDHLSGMPCTVLEGLFSSLTYFFSEDGAHICDYQLVLQCRIKREAGVVGDDWPCTFSLWCLNPSLVFKNIADASLSVILTSGTLSPMSSFQSELGVQFGTTLEAPHVINVESQLWAGVIPTGPEPDNWELNASYRTSGDYRFQDSVGKSLEEICKVVPGGCLVFFPSYNLMDKLRTRWSETGQWSRLNAQKPV...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G353120 |
|---|---|
| TK1151 ID | TkA02G353120 |
| OH-1004 ID | LXL04_015241 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 88.300 |
| Protein coverage (%) | TK1151 95.918 / OH-1004 30.104Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G353120 |
|---|---|
| Location | Chr02:89771658-89779637 (+) |
| Description | Similar to BRIP1: Fanconi anemia group J protein homolog |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000077 DNA damage checkpoint signaling Biological Process GO:0006281 DNA repair Biological Process GO:0006289 nucleotide-excision repair Biological Process GO:0006302 double-strand break repair Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0007129 homologous chromosome pairing at meiosis Biological Process GO:0007283 spermatogenesis Biological Process GO:0007284 spermatogonial cell division Biological Process GO:0007286 spermatid development Biological Process GO:0008285 negative regulation of cell population proliferation Biological Process GO:0010629 negative regulation of gene expression Biological Process GO:0010705 meiotic DNA double-strand break processing involved in reciprocal meiotic recombination Biological Process |
| KEGG gene cross-reference | gga:417642 hsa:83990 mmu:237911 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF13307Helicase_C_2217-359 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G353120 | PF13307 | Helicase_C_2 | 217 | 359 | 4.5e-26 | 92.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.