TkA02G342700 | RubberDandelionOmics

Gene overview

TkA02G342700

Reference: TK1151 Chr: Chr02 Coordinates: 87028519-87032141 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2209 bp · TkA02G342700|TK1151|cDNA

CGCGAGATAACATATGTCCACGTGTCACGTGTCTTCTCTCTTGGACAATCGTCCAGTTTGATGGCGCCCATACCTCTCTTGGTGACGGCAACGAAGCTCGCCGGAGTGTTAGCGACTATCACGGTAGCCGCCAACGCCGTCTCCTTCTCCCGTTTCAGGAAGAGAAATCTCGCACCATTTGACTCCCCTATCGATGAAACCTCCGACACTCTCGCCATCTTCAACAAGAAGAGGAAGGTTTCTTTTTCGGGCTAGCAACA...

CDS

Download CDS FASTA

1911 bp · TkA02G342700|TK1151|CDS

ATGGCGCCCATACCTCTCTTGGTGACGGCAACGAAGCTCGCCGGAGTGTTAGCGACTATCACGGTAGCCGCCAACGCCGTCTCCTTCTCCCGTTTCAGGAAGAGAAATCTCGCACCATTTGACTCCCCTATCGATGAAACCTCCGACACTCTCGCCATCTTCAACGTAAATTGCTCTGACTCTGACGATGAAGAGGAAGGTTTCTTTTTCGGGCTAGCAACAGCACCAGCTCATGTTGAAGATGGGCTCAATGATGCCTG...

Protein

Download Protein FASTA

636 aa · TkA02G342700|TK1151|PROTEIN

MAPIPLLVTATKLAGVLATITVAANAVSFSRFRKRNLAPFDSPIDETSDTLAIFNVNCSDSDDEEEGFFFGLATAPAHVEDGLNDAWLQFAQDEVVDKQDPSPDAVMASASGDGGSQQAAGPLKRKKSLKIAMEAKLRGLVKYIEDDESSSSSEEEEEEHNVAAWHNVPNPEERLRFWSDPDTELKLAKDTGVKVYRMGIDWTRIMPKEPVNGVKESINYAALERYRWIINRVQSYGMKVMLTLFHHSLPPWASDLGGWK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G342700`
TK1151 ID	TkA02G342700
OH-1004 ID	LXL04_015363
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G342700

Location Chr02:87028519-87032141 (-)

Description Similar to SFR2: Beta-glucosidase-like SFR2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g06510`	Glycosyl hydrolase family protein acting primarily as a highly specific galactosyltransferase.	The SENSITIVE TO FREEZING2 gene, required for freezing tolerance in Arabidopsis thaliana, encodes a beta-glucosidase.2004 · DOI: 10.1105/tpc.104.024018 A role for SENSITIVE TO FREEZING2 in protecting chloroplasts against freeze-induced damage in Arabidopsis.2008 · DOI: 10.1111/j.1365-313x.2008.03549.x Freezing tolerance in plants requires lipid remodeling at the outer chloroplast membrane.2010 · DOI: 10.1126/science.1191803 Structural determinants allowing transferase activity in SENSITIVE TO FREEZING 2, classified as a family I glycosyl hydrolase.2014 · DOI: 10.1074/jbc.m114.576694

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0683500`	Galactosyltransferase synthesizing digalactosyldiacylglycerol from monogalactosyldiacylglycerol in the absence of UDP-galactose (By similarity).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015363 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0009409 response to cold Biological Process

GO:0030245 cellulose catabolic process Biological Process

GO:0050826 response to freezing Biological Process

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009707 chloroplast outer membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0004565 beta-galactosidase activity Molecular Function

GO:0008378 galactosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT3G06510

dosa:Os11g0683500

osa:4351127

sshi:J5U23_00486

sso:SSO3019

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.533

Rank 1 · TkA02G342700 · TK1151

Endoplasmic reticulum0.138

Rank 2 · TkA02G342700 · TK1151

Cell membrane0.093

Rank 3 · TkA02G342700 · TK1151

Cytoplasm0.088

Rank 4 · TkA02G342700 · TK1151

Nucleus0.079

Rank 5 · TkA02G342700 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00232Glyco_hydro_1182-366 aa

PF00150Cellulase183-270 aa

PF00232Glyco_hydro_1388-535 aa

PF08868YugN418-472 aa

PF00150Cellulase438-491 aa

PF08868YugN489-503 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G342700	`PF00232`	Glyco_hydro_1	182	366	8.7e-55	186.8
TkA02G342700	`PF00150`	Cellulase	183	270	0.0022	18.3
TkA02G342700	`PF00232`	Glyco_hydro_1	388	535	8.7e-55	186.8
TkA02G342700	`PF08868`	YugN	418	472	0.24	12.1
TkA02G342700	`PF00150`	Cellulase	438	491	0.0022	18.3
TkA02G342700	`PF08868`	YugN	489	503	0.24	12.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93Y07`	Arabidopsis thaliana	sp\|Q93Y07\|SFR2_ARATH Galactolipid galactosyltransferase SFR2, chloroplastic	64.500%	Swiss-Prot	High
`Q8L6H7`	Oryza sativa subsp. japonica	sp\|Q8L6H7\|SFR2_ORYSJ Beta-glucosidase-like SFR2, chloroplastic	68.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card