TkA02G341450 | RubberDandelionOmics

Gene overview

TkA02G341450

Reference: TK1151 Chr: Chr02 Coordinates: 86733918-86737612 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2391 bp · TkA02G341450|TK1151|cDNA

AGAGGATGCACTGAATTCTGTTCGACATTTCTTCGCCGGGTTTTAAACCCCCAAAATCTTACCGCTTCTTAAGCTTCACCTGGTTAGATTTTTGTCAATCCCAGTTGTGCTTCTATGTCTCTATCAACGTGTATCTGTATATTTGCTTCATTCGTGTGTTTTTGTGGAATTTTTCTTTGACTGCTGTATTGGTTATGCTTGCTAAAGCTCCAACTTTAGTCATTTTCATGTGAAGGTTCGTGAACATCCGCGCAATTAGT...

CDS

Download CDS FASTA

1542 bp · TkA02G341450|TK1151|CDS

ATGGGTAAGATTAAGATCCGCTGCTTCTCCACTTCATTTTCTAAAGAACCTTCCATGGTTCCATGGATTTCCCCCCTTCATTACACAAAAGCCACATCACCAAAACCAGACCCCCCTCCAACAACCACCATCACACAAACCCTAAAAAACCCTAAATTTACTTCTCATGAATCAGCAATCAGATTAATAAAACGCGAGAAAGATCCACACAAAATCCTTACAATCTTTAAAAAAGTAGCTAACCAAAGGGGCTTTAATCA...

Protein

Download Protein FASTA

513 aa · TkA02G341450|TK1151|PROTEIN

MGKIKIRCFSTSFSKEPSMVPWISPLHYTKATSPKPDPPPTTTITQTLKNPKFTSHESAIRLIKREKDPHKILTIFKKVANQRGFNHNHSTYAVTLHKLAHLKHLKEVDYVLHQMSYETCKFHESIFLDLMTHYSKSSLHTKVIDMFNSIQPIVREKPSLKAVSTCLNLLVESNQVDLARSFLLYSKKTLDLHPNTCIFNILVKHHCKNGNLESAIEVMKEMKLSKVSYPNLITYSTLMEGFCKNGRLEEAIDLFEQMVS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G341450`
TK1151 ID	TkA02G341450
OH-1004 ID	LXL04_031134
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	95.000
Protein coverage (%)	TK1151 58.480 / OH-1004 50.251 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G341450

Location Chr02:86733918-86737612 (-)

Description Similar to At5g18475: Pentatricopeptide repeat-containing protein At5g18475

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g18475`	Pentatricopeptide repeat-containing protein At5g18475.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031134 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006397 mRNA processing Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G07740

ath:AT5G18475

ath:AT5G46100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.849

Rank 1 · TkA02G341450 · TK1151

Plastid0.077

Rank 2 · TkA02G341450 · TK1151

Nucleus0.057

Rank 3 · TkA02G341450 · TK1151

Cytoplasm0.031

Rank 4 · TkA02G341450 · TK1151

Cell membrane0.010

Rank 5 · TkA02G341450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29070MSC6_N33-220 aa

PF17177PPR_long56-151 aa

PF13812PPR_360-80 aa

PF13424TPR_1265-104 aa

PF22069Androglobin_IV70-116 aa

PF13812PPR_380-121 aa

PF13041PPR_282-100 aa

PF01535PPR96-115 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G341450	`PF29070`	MSC6_N	33	220	9.5e-25	88.2
TkA02G341450	`PF17177`	PPR_long	56	151	3.1e-21	76.5
TkA02G341450	`PF13812`	PPR_3	60	80	6e-32	110.2
TkA02G341450	`PF13424`	TPR_12	65	104	0.017	16.0
TkA02G341450	`PF22069`	Androglobin_IV	70	116	0.064	13.9
TkA02G341450	`PF13812`	PPR_3	80	121	6e-32	110.2
TkA02G341450	`PF13041`	PPR_2	82	100	1.6e-83	275.4
TkA02G341450	`PF01535`	PPR	96	115	1.8e-53	175.8
TkA02G341450	`PF29978`	ATP18_TPR	98	121	0.014	16.0
TkA02G341450	`PF23276`	TPR_24	100	136	1.7e-21	77.2
TkA02G341450	`PF28737`	VPS18_solenoid_2nd	100	100	0.16	12.5
TkA02G341450	`PF29834`	SOV1_C	102	151	0.018	14.8
TkA02G341450	`PF13041`	PPR_2	130	149	1.6e-83	275.4
TkA02G341450	`PF01535`	PPR	130	149	1.8e-53	175.8
TkA02G341450	`PF00637`	Clathrin	132	146	0.011	16.2
TkA02G341450	`PF24760`	TPR_IF140_C	139	223	9.3e-07	30.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q3E9F0`	Arabidopsis thaliana	sp\|Q3E9F0\|PP392_ARATH Pentatricopeptide repeat-containing protein At5g18475	56.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card