TkA02G336810 | RubberDandelionOmics

Gene overview

TkA02G336810

Reference: TK1151 Chr: Chr02 Coordinates: 85497557-85500390 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2176 bp · TkA02G336810|TK1151|cDNA

ATAAAATCCACCGTTTACGACTTTACGTAGGTTGTGCTGCGACGGCGAGACCGGGAAGGGGCGGAGGGCGAAGACGCAGCGGCAGACGCCTTGGAGAAACTCATCAAAAGAGGAGATGAAAGTTCATCGCAAGAGTTCGGATAGAATCAGCGCGCTTCCTGAAGATACAGTTTCACAAATTCTGAGTCATATGCCAATTCGAGATGCAGTGAGGACGAGCATCTTGTCAAGGAAATGGAGGTATCGTTGGACTAGCATGC...

CDS

Download CDS FASTA

1242 bp · TkA02G336810|TK1151|CDS

ATGAAAGTTCATCGCAAGAGTTCGGATAGAATCAGCGCGCTTCCTGAAGATACAGTTTCACAAATTCTGAGTCATATGCCAATTCGAGATGCAGTGAGGACGAGCATCTTGTCAAGGAAATGGAGGTATCGTTGGACTAGCATGCCCAAACTTGTATTTAATGATGAGAGCCTGGCTGTATTAACTGATGACGAAGATATCAATAAATATAAGTTTGTCGATGCCATCTTCCACGTTTTGTTGCTGCACAAAGGTCCAAT...

Protein

Download Protein FASTA

413 aa · TkA02G336810|TK1151|PROTEIN

MKVHRKSSDRISALPEDTVSQILSHMPIRDAVRTSILSRKWRYRWTSMPKLVFNDESLAVLTDDEDINKYKFVDAIFHVLLLHKGPILEFSLSVTGKEIYSEIDQIILHLLRNNNIKKFTLEILETDRSYLLPGSLFSLQGLEHLDLSYCAFDRCPLMNKGFSTLKSLSFSDVDITNKMLFKFLTNCPLLEEFTWARDYYINIELTESELVKLFKNLPSVHVLHISKLYIKVIPNLLFNLMQMKSCFKSIWLKHLAAGTM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G336810`
TK1151 ID	TkA02G336810
OH-1004 ID	LXL04_015139
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	57.200
Protein coverage (%)	TK1151 97.579 / OH-1004 34.492 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G336810

Location Chr02:85497557-85500390 (+)

Description Similar to At1g13570: F-box/FBD/LRR-repeat protein At1g13570

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g13570`	F-box/FBD/LRR-repeat protein At1g13570.	No verified direct reference in this release
`At5g52460`	Putative F-box/FBD/LRR-repeat protein At5g52460.	No verified direct reference in this release
`At3g26922`	F-box/LRR-repeat protein At3g26922.	No verified direct reference in this release
`At3g51530`	F-box/FBD/LRR-repeat protein At3g51530.	No verified direct reference in this release
`At4g00160`	F-box/FBD/LRR-repeat protein At4g00160.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015139 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G13570

ath:AT5G56370

ath:AT5G56440

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.718

Rank 1 · TkA02G336810 · TK1151

Cytoplasm0.360

Rank 2 · TkA02G336810 · TK1151

Endoplasmic reticulum0.052

Rank 3 · TkA02G336810 · TK1151

Cell membrane0.047

Rank 4 · TkA02G336810 · TK1151

Plastid0.021

Rank 5 · TkA02G336810 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box11-50 aa

PF12937F-box-like11-42 aa

PF23622LRR_At1g61320_AtMIF141-70 aa

PF23622LRR_At1g61320_AtMIF1101-197 aa

PF24758LRR_At5g56370108-196 aa

PF13855LRR_8111-118 aa

PF06662C5-epim_C117-168 aa

PF13855LRR_8134-149 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G336810	`PF00646`	F-box	11	50	3.7e-09	36.8
TkA02G336810	`PF12937`	F-box-like	11	42	0.001	19.5
TkA02G336810	`PF23622`	LRR_At1g61320_AtMIF1	41	70	1.4e-09	38.5
TkA02G336810	`PF23622`	LRR_At1g61320_AtMIF1	101	197	1.4e-09	38.5
TkA02G336810	`PF24758`	LRR_At5g56370	108	196	6.1e-11	43.1
TkA02G336810	`PF13855`	LRR_8	111	118	7.6	7.1
TkA02G336810	`PF06662`	C5-epim_C	117	168	0.23	11.6
TkA02G336810	`PF13855`	LRR_8	134	149	7.6	7.1
TkA02G336810	`PF28313`	DUF8380	160	231	0.0059	16.3
TkA02G336810	`PF28505`	DUF1699_N	176	201	0.021	15.2
TkA02G336810	`PF08387`	FBD	190	199	1.9e-06	28.4
TkA02G336810	`PF28505`	DUF1699_N	200	243	0.021	15.2
TkA02G336810	`PF00646`	F-box	210	227	3.7e-09	36.8
TkA02G336810	`PF13855`	LRR_8	213	240	7.6	7.1
TkA02G336810	`PF24758`	LRR_At5g56370	261	305	6.1e-11	43.1
TkA02G336810	`PF23622`	LRR_At1g61320_AtMIF1	267	368	1.4e-09	38.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FZ70`	Arabidopsis thaliana	sp\|Q9FZ70\|FDL1_ARATH F-box/FBD/LRR-repeat protein At1g13570	31.400%	Swiss-Prot	Medium
`Q9FHB5`	Arabidopsis thaliana	sp\|Q9FHB5\|FDL42_ARATH Putative F-box/FBD/LRR-repeat protein At5g52460	27.400%	Swiss-Prot	Low
`Q9LJF8`	Arabidopsis thaliana	sp\|Q9LJF8\|FBL47_ARATH F-box/LRR-repeat protein At3g26922	28.000%	Swiss-Prot	Low
`Q501E9`	Arabidopsis thaliana	sp\|Q501E9\|FDL20_ARATH F-box/FBD/LRR-repeat protein At3g51530	28.300%	Swiss-Prot	Low
`Q8LF09`	Arabidopsis thaliana	sp\|Q8LF09\|FDL23_ARATH F-box/FBD/LRR-repeat protein At4g00160	27.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card