TkA02G336660 | RubberDandelionOmics

Gene overview

TkA02G336660

Reference: TK1151 Chr: Chr02 Coordinates: 85434275-85435831 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1186 bp · TkA02G336660|TK1151|cDNA

CTTGGTGGGTAAGGACGCAACGGTCAACTTTATAATAGGGTTCCAAATAAAAAACCCAATTGCGCTATAATCTTTCTCTGCAGATTTGCTCTCGCTCACCAAAGGGGTTCATTGTTACCTTCATCTTTAACCACACAACCACCATGTCCGGAAAAGAAGAAAAGGGGGGCACACAGGACGCGGCCGAACGAATCAAGGCGGCAACACTCTCCGCCGCCAAAGGCCTCAGCCGATCTCAGGCGGAACGTGCCGCCGCGGCC...

CDS

Download CDS FASTA

816 bp · TkA02G336660|TK1151|CDS

ATGTCCGGAAAAGAAGAAAAGGGGGGCACACAGGACGCGGCCGAACGAATCAAGGCGGCAACACTCTCCGCCGCCAAAGGCCTCAGCCGATCTCAGGCGGAACGTGCCGCCGCGGCCGCCGCCCGAAATGTCAATGCGTACGGACAAAAAGAAGAAGGGCCAAGCAGATGGCAAGAAAGGAAAGAAGCCAAACGACAAATGTACCTCATGAGTACCGAAAAGCAAGTAAGACTAGGTGAAAGAAAAGACCTCAAAACCTC...

Protein

Download Protein FASTA

271 aa · TkA02G336660|TK1151|PROTEIN

MSGKEEKGGTQDAAERIKAATLSAAKGLSRSQAERAAAAAARNVNAYGQKEEGPSRWQERKEAKRQMYLMSTEKQVRLGERKDLKTSTPTATNCQKCFQPGHWTYECKNERVYISRPSRTQQLKNPKLRMRAPVSYDLDNPEIGKQEEKKKSRSGDKNKKRKHGSGSDSDSVSDSDSEASVFESGSESASVTGSDSDSDSSDSSDSDSGEERRRRSKKNKKKKVRGEKKRKHRRHSSSSESESDSESGSESESDSDDSRS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G336660`
TK1151 ID	TkA02G336660
OH-1004 ID	LXL04_005387
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	65.300
Protein coverage (%)	TK1151 34.686 / OH-1004 15.217 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G336660`
Location	Chr02:85434275-85435831 (+)
Description	Similar to At3g47200: UPF0481 protein At3g47200
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005387` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0016020 membrane Cellular Component
KEGG gene cross-reference	ath:AT3G02645 ath:AT3G47200 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.940

Rank 1 · TkA02G336660 · TK1151

Cytoplasm0.151

Rank 2 · TkA02G336660 · TK1151

Cell membrane0.026

Rank 3 · TkA02G336660 · TK1151

Mitochondrion0.018

Rank 4 · TkA02G336660 · TK1151

Endoplasmic reticulum0.014

Rank 5 · TkA02G336660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30483AAA_SpoVK_2nd20-43 aa

PF29721TMEM129_C60-122 aa

PF13917zf-CCHC_391-126 aa

PF00098zf-CCHC94-109 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G336660	`PF30483`	AAA_SpoVK_2nd	20	43	0.038	14.6
TkA02G336660	`PF29721`	TMEM129_C	60	122	0.034	15.2
TkA02G336660	`PF13917`	zf-CCHC_3	91	126	3.3e-22	78.7
TkA02G336660	`PF00098`	zf-CCHC	94	109	0.46	11.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card