TkA02G302360 | RubberDandelionOmics

Gene overview

TkA02G302360

Reference: TK1151 Chr: Chr02 Coordinates: 77052231-77053224 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

630 bp · TkA02G302360|TK1151|cDNA

CTACAACACCCTGATTCCAAGCCTTTTGTCCATGATTTGCTTTTATCAATGGCTCTTGCAGAGTGTGCTATAGCAAAATCAAACTTTGAAAAGAACAAGATTTCTCAAAGATTTGAAGCTTTAGCTCGTGCACAGTCTCTTCTCAAAAGCAAACCTTCACTTGAACAAATGACATTATTATCTCAGATTGAGGAATCTTTGGAAGAACTTGCACCTGCTTGCACACTGGAGCTATTAGGCATGCCTCACTCACAAGAAAA...

CDS

Download CDS FASTA

582 bp · TkA02G302360|TK1151|CDS

ATGGCTCTTGCAGAGTGTGCTATAGCAAAATCAAACTTTGAAAAGAACAAGATTTCTCAAAGATTTGAAGCTTTAGCTCGTGCACAGTCTCTTCTCAAAAGCAAACCTTCACTTGAACAAATGACATTATTATCTCAGATTGAGGAATCTTTGGAAGAACTTGCACCTGCTTGCACACTGGAGCTATTAGGCATGCCTCACTCACAAGAAAATGCTGAGAGAAGAGTAGGGGCAATTGCAGCATTAAGAGAGCTCTTAAG...

Protein

Download Protein FASTA

194 aa · TkA02G302360|TK1151|PROTEIN

MALAECAIAKSNFEKNKISQRFEALARAQSLLKSKPSLEQMTLLSQIEESLEELAPACTLELLGMPHSQENAERRVGAIAALRELLRQGLDVDSQCQIDDWSNFLNQALNKLTAAEITELLTWDSLVNTRKNKKSLESQNQRTVIDASCLYTVMMAHIALGFSSKQIEMINKGKSICECLVASEGIDLKLEEAF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G302360`
TK1151 ID	TkA02G302360
OH-1004 ID	LXL04_015674
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 41.631 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G302360

Location Chr02:77052231-77053224 (-)

Description Similar to CDP1: Plastid division protein CDP1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g19180`	Component of the plastid division machinery required for PDV1 localization to constriction sites.	PARC6, a novel chloroplast division factor, influences FtsZ assembly and is required for recruitment of PDV1 during chloroplast division in Arabidopsis.2009 · DOI: 10.1111/j.1365-313x.2009.03905.x CDP1, a novel component of chloroplast division site positioning system in Arabidopsis.2009 · DOI: 10.1038/cr.2009.78 The chloroplast min system functions differentially in two specific nongreen plastids in Arabidopsis thaliana.2013 · DOI: 10.1371/journal.pone.0071190 Roles of Arabidopsis PARC6 in Coordination of the Chloroplast Division Complex and Negative Regulation of FtsZ Assembly.2016 · DOI: 10.1104/pp.15.01460 Isolation and analysis of a stromule-overproducing Arabidopsis mutant suggest the role of PARC6 in plastid morphology maintenance in the leaf epidermis.2018 · DOI: 10.1111/ppl.12648 ARC3 Activation by PARC6 Promotes FtsZ-Ring Remodeling at the Chloroplast Division Site.2019 · DOI: 10.1105/tpc.18.00948

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015674 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009658 chloroplast organization Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0010020 chloroplast fission Biological Process

GO:0043572 plastid fission Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009528 plastid inner membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0009706 chloroplast inner membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0042803 protein homodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT3G19180

ath:AT5G42480

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.507

Rank 1 · TkA02G302360 · TK1151

Nucleus0.420

Rank 2 · TkA02G302360 · TK1151

Mitochondrion0.076

Rank 3 · TkA02G302360 · TK1151

Cell membrane0.069

Rank 4 · TkA02G302360 · TK1151

Endoplasmic reticulum0.057

Rank 5 · TkA02G302360 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25515Arm_PDR1-101 aa

PF23468ARC634-34 aa

PF25515Arm_PDR105-136 aa

PF23468ARC6139-183 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G302360	`PF25515`	Arm_PDR	1	101	3.4e-27	96.0
TkA02G302360	`PF23468`	ARC6	34	34	0.052	13.7
TkA02G302360	`PF25515`	Arm_PDR	105	136	3.4e-27	96.0
TkA02G302360	`PF23468`	ARC6	139	183	0.052	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VY16`	Arabidopsis thaliana	sp\|Q8VY16\|CDP1_ARATH Plastid division protein CDP1, chloroplastic	70.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card