Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2444 bp · TkA02G290220|TK1151|cDNA
GTCACTTCGATGTACGGGGTCTGCGGAGAGAATTCCGCAGAGAGACAGACAGTTTCGCAGAGACAGCTCTGCGAAACTACCACCCCTTCCGCGGAACTGCAGCGAAATGACGACCATAACCCTGCTGTTTCGAGGGGCTCTGCGGATCCGCAGAGCTGGCTCTGCGGAATCCTTCACTTACCGCGGAACTGAAATTTTATTTACAAGTATGCCATTTCGCGGGACTTGTCCCATTTCGCAGAGGGTCCTCTCTGTGGAAA...
1458 bp · TkA02G290220|TK1151|CDS
ATGGATACATCAAAAGATTCAACCGTAATGGATGTGAGGTCTGTTGTTGAAGCTGTTTCTACCCACGATGATGACGCTCCTGTGTACCAGGTCGAGAGCCTCTGCATGCGATGTGGTGAAAATGGGACAACGAGATTCCTGTTGACTTTGATTCCACACTTTAGGCAGATATTGTTGTCAGCCTTTGAGTGTCCTCATTGTGGTGAGAGGAACAATGAGGTGCAGTTTGCTGGTGAGATACAGCCCCGAGGTTGTTGCTA...
Protein
Download Protein FASTA485 aa · TkA02G290220|TK1151|PROTEIN
MDTSKDSTVMDVRSVVEAVSTHDDDAPVYQVESLCMRCGENGTTRFLLTLIPHFRQILLSAFECPHCGERNNEVQFAGEIQPRGCCYRFEFSSGDQKMLNRQVVKSETATIKIPQLEFEIPPESQRGSLSTVEGILVRSADNLQALQEERKKIDPQTAEAIDKFILKLRACATGNSSFTFILDDPAGNSFIENPYAPSPDPSLTIDFYERTPDQQAALGYLVDQSQSREIGNENDLTNNQTSEAHGSVGAVAGRRAIAQG...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G290220 |
|---|---|
| TK1151 ID | TkA02G290220 |
| OH-1004 ID | LXL04_015753 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 84.500 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G290220 |
|---|---|
| Location | Chr02:74160938-74165914 (+) |
| Description | Similar to zpr1: Zinc finger protein ZPR1 homolog |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000086 G2/M transition of mitotic cell cycle Biological Process GO:0000226 microtubule cytoskeleton organization Biological Process GO:0006260 DNA replication Biological Process GO:0006397 mRNA processing Biological Process GO:0006457 protein folding Biological Process GO:0006458 'de novo' protein folding Biological Process GO:0008380 RNA splicing Biological Process GO:0009749 response to glucose Biological Process GO:0010628 positive regulation of gene expression Biological Process GO:0030576 Cajal body organization Biological Process GO:0033120 positive regulation of RNA splicing Biological Process GO:0042023 DNA endoreduplication Biological Process |
| KEGG gene cross-reference | ddi:DDB_G0269438 mmu:22687 sce:YGR211W These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF07191Zn_ribbon_629-40 aaPF03367Zn_ribbon_ZPR130-82 aaPF01155HypA30-75 aaPF06170DUF98330-41 aaPF28914Trissin32-41 aaPF12773DZR33-71 aaPF07191Zn_ribbon_635-72 aaPF06750A24_N_bact50-69 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G290220 | PF07191 | Zn_ribbon_6 | 29 | 40 | 1.0 | 10.1 |
| TkA02G290220 | PF03367 | Zn_ribbon_ZPR1 | 30 | 82 | 5.6e-50 | 167.3 |
| TkA02G290220 | PF01155 | HypA | 30 | 75 | 0.12 | 13.2 |
| TkA02G290220 | PF06170 | DUF983 | 30 | 41 | 9.0 | 7.4 |
| TkA02G290220 | PF28914 | Trissin | 32 | 41 | 1.8 | 9.2 |
| TkA02G290220 | PF12773 | DZR | 33 | 71 | 0.53 | 11.2 |
| TkA02G290220 | PF07191 | Zn_ribbon_6 | 35 | 72 | 1.0 | 10.1 |
| TkA02G290220 | PF06750 | A24_N_bact | 50 | 69 | 0.2 | 12.4 |
| TkA02G290220 | PF06170 | DUF983 | 54 | 72 | 9.0 | 7.4 |
| TkA02G290220 | PF28914 | Trissin | 60 | 90 | 1.8 | 9.2 |
| TkA02G290220 | PF14690 | Zn_ribbon_ISL3 | 63 | 83 | 4.9 | 8.3 |
| TkA02G290220 | PF00641 | Zn_ribbon_RanBP | 63 | 72 | 7.5 | 6.6 |
| TkA02G290220 | PF22794 | jr-ZPR1 | 98 | 220 | 1.6e-83 | 277.5 |
| TkA02G290220 | PF28914 | Trissin | 271 | 294 | 1.8 | 9.2 |
| TkA02G290220 | PF06750 | A24_N_bact | 273 | 292 | 0.2 | 12.4 |
| TkA02G290220 | PF03367 | Zn_ribbon_ZPR1 | 277 | 331 | 5.6e-50 | 167.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.