TkA02G283330 | RubberDandelionOmics

Gene overview

TkA02G283330

Reference: TK1151 Chr: Chr02 Coordinates: 72304800-72308458 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1957 bp · TkA02G283330|TK1151|cDNA

TCCCGCTCGCCGTCATCGACAAAATCATACGAATTTCAAAATTAGAAAATTTTCCTCAAACGAGATTCAATAATGTTGGAAAACTTTCCCAAAAGTGAGATTTTTAACGGAAACAATTGAAAATTGAATTCGAGGAAGAATTTTCAATTCGATAGAAGAAAGTTTTCTGAATCGATTATCGATTGAAGGAGGTCTTGAATCAATTAATGTATAGCATTGAGCTTTTTTTTAGAACAACGCAAGGAGCTCCATCATCGTCT...

CDS

Download CDS FASTA

1392 bp · TkA02G283330|TK1151|CDS

ATGGCTGGTGAAGAACCGAGAAAAGGTTATCACCTATCTCGTGTCCTAAAGAAAATCTTGGAAAGTAAATCTCCTCACGAAGAACACAAAACAGTTGGGCGTTCTGCTTCTGCACAAGATTTGAGATTCTTTGAGATGGAAAAGGAAAAAGAAGATGTGACTTCCCCTAGAGGAGTTTTAGAGGCATGTGTAAGAAGCTTTGAGGACTCAAATTTATCTGAAGATAACCAAAGAAATGAAACCGTATCGCACCCACGTTC...

Protein

Download Protein FASTA

463 aa · TkA02G283330|TK1151|PROTEIN

MAGEEPRKGYHLSRVLKKILESKSPHEEHKTVGRSASAQDLRFFEMEKEKEDVTSPRGVLEACVRSFEDSNLSEDNQRNETVSHPRSRWVKFFKMWKKNFSKKVPTLPPVTPKTSRRKSTSVKENHPDVNFCHFKSSWKVLTIDELNAATNNFSEENVIGKGGYADVYKGCLCDGKLVAIKRLNKGTMEEQIIGFLSEIGTIAHVDHPNTAKLIGYGIEGGTHLVMELSPHGSLGSLLRDGPKEKLDWDARYKIIHGTAN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G283330`
TK1151 ID	TkA02G283330
OH-1004 ID	LXL04_016021
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.500
Protein coverage (%)	TK1151 98.704 / OH-1004 95.082 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G283330

Location Chr02:72304800-72308458 (-)

Description Similar to RBK2: Receptor-like cytosolic serine/threonine-protein kinase RBK2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g05140`	Receptor-like cytosolic serine/threonine-protein kinase RBK2.	No verified direct reference in this release
`At5g10520`	Receptor-like cytosolic serine/threonine-protein kinase RBK1.	No verified direct reference in this release
`At5g57670`	Probable receptor-like serine/threonine-protein kinase At5g57670.	No verified direct reference in this release
`At3g18810`	Putative proline-rich receptor-like protein kinase PERK6.	No verified direct reference in this release
`At1g60800`	Receptor kinase acting, redundantly with other CIKs (e.g. CIK1, CIK2, CIK3, CIK5 and CIK6), as a coreceptor of CLV1, CLV2/CRN and RPK2, and required for CLAVATA-family peptides (e.g. CLV3) signaling through phosphorylation; this signaling regulates protophloem differentiation and the maintenance of shoot apical meristem (SAM) and root apical meristem (RAM) homeostasis, and acts down-stream of BRX and OPS.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016021 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0071369 cellular response to ethylene stimulus Biological Process

GO:0098542 defense response to other organism Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G26150

ath:AT3G05140

ath:AT5G10520

ath:AT5G38560

ath:AT5G57670

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.669

Rank 1 · TkA02G283330 · TK1151

Cytoplasm0.257

Rank 2 · TkA02G283330 · TK1151

Nucleus0.256

Rank 3 · TkA02G283330 · TK1151

Endoplasmic reticulum0.038

Rank 4 · TkA02G283330 · TK1151

Golgi apparatus0.026

Rank 5 · TkA02G283330 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14748P5CR_dimer45-74 aa

PF00069Pkinase154-359 aa

PF07714PK_Tyr_Ser-Thr156-363 aa

PF03109ABC1156-186 aa

PF03109ABC1264-305 aa

PF01636APH267-301 aa

PF17667Pkinase_fungal270-322 aa

PF14748P5CR_dimer418-448 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G283330	`PF14748`	P5CR_dimer	45	74	0.39	11.7
TkA02G283330	`PF00069`	Pkinase	154	359	8.3e-39	134.3
TkA02G283330	`PF07714`	PK_Tyr_Ser-Thr	156	363	1.9e-39	136.3
TkA02G283330	`PF03109`	ABC1	156	186	0.0093	15.9
TkA02G283330	`PF03109`	ABC1	264	305	0.0093	15.9
TkA02G283330	`PF01636`	APH	267	301	0.02	15.4
TkA02G283330	`PF17667`	Pkinase_fungal	270	322	0.079	12.4
TkA02G283330	`PF14748`	P5CR_dimer	418	448	0.39	11.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RXC8`	Arabidopsis thaliana	sp\|Q8RXC8\|RBK2_ARATH Receptor-like cytosolic serine/threonine-protein kinase RBK2	57.900%	Swiss-Prot	High
`Q8H1D6`	Arabidopsis thaliana	sp\|Q8H1D6\|RBK1_ARATH Receptor-like cytosolic serine/threonine-protein kinase RBK1	43.200%	Swiss-Prot	Medium
`Q5XF57`	Arabidopsis thaliana	sp\|Q5XF57\|Y5576_ARATH Probable receptor-like serine/threonine-protein kinase At5g57670	50.500%	Swiss-Prot	Medium
`Q9LS95`	Arabidopsis thaliana	sp\|Q9LS95\|PERK6_ARATH Putative proline-rich receptor-like protein kinase PERK6	43.500%	Swiss-Prot	Medium
`Q93ZS4`	Arabidopsis thaliana	sp\|Q93ZS4\|CIK1_ARATH Protein CLAVATA3 INSENSITIVE RECEPTOR KINASE 1	42.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card