TkA02G262690 | RubberDandelionOmics

Gene overview

TkA02G262690

Reference: TK1151 Chr: Chr02 Coordinates: 67275759-67276854 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

987 bp · TkA02G262690|TK1151|cDNA

ATGGCGGGAGGAAAAATCAGGAAAGAAAAGGCCCCACGTGGAGTTGTTGGCTCTTCTAATCACTACCAAGGAGGCATACAATTCCACAAGTCAAAAGGTCAACACATCCTCAAGAACCCTCTACTCGTTGATTCCATTGTCCAAAAAGCCGGAATCAACCCCACAGACATAATTCTTGAAATTGGTCCGGGTACTGGTAATCTCACCAAGAAGCTTCTAGAAGCTGGCAAATCGGTTATTGCAGTTGAACTCGATCCACG...

CDS

Download CDS FASTA

987 bp · TkA02G262690|TK1151|CDS

ATGGCGGGAGGAAAAATCAGGAAAGAAAAGGCCCCACGTGGAGTTGTTGGCTCTTCTAATCACTACCAAGGAGGCATACAATTCCACAAGTCAAAAGGTCAACACATCCTCAAGAACCCTCTACTCGTTGATTCCATTGTCCAAAAAGCCGGAATCAACCCCACAGACATAATTCTTGAAATTGGTCCGGGTACTGGTAATCTCACCAAGAAGCTTCTAGAAGCTGGCAAATCGGTTATTGCAGTTGAACTCGATCCACG...

Protein

Download Protein FASTA

328 aa · TkA02G262690|TK1151|PROTEIN

MAGGKIRKEKAPRGVVGSSNHYQGGIQFHKSKGQHILKNPLLVDSIVQKAGINPTDIILEIGPGTGNLTKKLLEAGKSVIAVELDPRMVLELQRRFQGTPFSNRLKVIHGDVLKCDLPYFDICVANIPYQISSPLTFKLLNHKPSFRCAIIMFQREFAMRLVAQPSDSLYCRLSVNTQLLARVSHLLKVAKNNFRPPPKVDSSVVRIEPRKPPPVVNFKEWDGLVRICFTRKNKTLGSIFRQKRVLSIMEKNYKTLQALG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G262690`
TK1151 ID	TkA02G262690
OH-1004 ID	LXL04_026767
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	33.000
Protein coverage (%)	TK1151 63.110 / OH-1004 65.782 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G262690

Location Chr02:67275759-67276854 (-)

Description Similar to PFC1: Ribosomal RNA small subunit methyltransferase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g47420`	N6-adenine methyltransferase which modifies the AA dinucleotide at the plant nuclear 18S rRNA nucleotides A1785 and A1786.	Nuclear ribosome biogenesis mediated by the DIM1A rRNA dimethylase is required for organized root growth and epidermal patterning in Arabidopsis.2012 · DOI: 10.1105/tpc.112.101022

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026767 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0031167 rRNA methylation Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0000179 rRNA (adenine-N6,N6-)-dimethyltransferase activity Molecular Function

GO:0003723 RNA binding Molecular Function

GO:0016422 mRNA (2'-O-methyladenosine-N6-)-methyltransferase activity Molecular Function

GO:0052908 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase activity Molecular Function

KEGG gene cross-reference

ana:alr3229

ath:AT1G01860

cmu:TC_0633

mta:Moth_0052

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.739

Rank 1 · TkA02G262690 · TK1151

Mitochondrion0.220

Rank 2 · TkA02G262690 · TK1151

Cytoplasm0.175

Rank 3 · TkA02G262690 · TK1151

Cell membrane0.026

Rank 4 · TkA02G262690 · TK1151

Endoplasmic reticulum0.013

Rank 5 · TkA02G262690 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00398RrnaAD27-255 aa

PF01135PCMT37-113 aa

PF00891Methyltransf_241-123 aa

PF05185PRMT545-125 aa

PF02006PPS_PS45-86 aa

PF13489Methyltransf_2346-96 aa

PF05219DREV53-95 aa

PF02636Methyltransf_2857-79 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G262690	`PF00398`	RrnaAD	27	255	2.9e-67	227.3
TkA02G262690	`PF01135`	PCMT	37	113	0.034	14.6
TkA02G262690	`PF00891`	Methyltransf_2	41	123	0.14	12.2
TkA02G262690	`PF05185`	PRMT5	45	125	0.0074	16.9
TkA02G262690	`PF02006`	PPS_PS	45	86	0.02	15.1
TkA02G262690	`PF13489`	Methyltransf_23	46	96	0.0021	18.5
TkA02G262690	`PF05219`	DREV	53	95	0.31	10.8
TkA02G262690	`PF02636`	Methyltransf_28	57	79	0.22	11.7
TkA02G262690	`PF02390`	Methyltransf_4	57	114	0.25	11.5
TkA02G262690	`PF13649`	Methyltransf_25	58	126	8.7e-09	36.7
TkA02G262690	`PF08241`	Methyltransf_11	59	125	1.1e-06	29.9
TkA02G262690	`PF08242`	Methyltransf_12	59	126	1.8e-06	29.3
TkA02G262690	`PF29244`	Methyltransf_ANTKMT	60	140	5.9e-05	24.2
TkA02G262690	`PF05185`	PRMT5	243	259	0.0074	16.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22268`	Arabidopsis thaliana	sp\|O22268\|DIM1A_ARATH Ribosomal RNA small subunit methyltransferase	71.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card