TkA02G260430 | RubberDandelionOmics

Gene overview

TkA02G260430

Reference: TK1151 Chr: Chr02 Coordinates: 66429981-66432431 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1093 bp · TkA02G260430|TK1151|cDNA

AAAAATTCGTTTTTTGTATCTTTCTTACTATTTTCTTAATTATTTTGCATATTTTATACACTTGACATGAACAGTTTTTGGTCGGAAGGAGATCACGACACAAAAGCTCCAGTCAAAATAACAAAAGACAAGAACGGTGTTGATCTTGTTACACTTCAAAACCAAAGAGGGTTTTCCGTACAGGTTAGTTTGCATGGTGGTCAAGTTCTTTCGTGGAAAAACGAACGCGGTGAAGAACTGTTGTTTAGAAGTAGTAAGGC...

CDS

Download CDS FASTA

921 bp · TkA02G260430|TK1151|CDS

ATGAACAGTTTTTGGTCGGAAGGAGATCACGACACAAAAGCTCCAGTCAAAATAACAAAAGACAAGAACGGTGTTGATCTTGTTACACTTCAAAACCAAAGAGGGTTTTCCGTACAGGTTAGTTTGCATGGTGGTCAAGTTCTTTCGTGGAAAAACGAACGCGGTGAAGAACTGTTGTTTAGAAGTAGTAAGGCAAACTCCAAACCACCTGCAGCAGTAAGAGGTGGAATTCCCATATGCTTTCCACAGTTTGGAAATCG...

Protein

Download Protein FASTA

306 aa · TkA02G260430|TK1151|PROTEIN

MNSFWSEGDHDTKAPVKITKDKNGVDLVTLQNQRGFSVQVSLHGGQVLSWKNERGEELLFRSSKANSKPPAAVRGGIPICFPQFGNRGCLEQHGFARNKIWEFENNPPLLHHNNRNDNAFIDLLLKPTEEDMRIWPHSYEFRLRVLLTSDGALKLISRIRNIGSKEFSFSIAYHTYFLVSDIGEVRVEGLETLDYLDNLHHKQRFTEQGDTLTFESEVDRVYIGSPHIIGVFDHEKRRTFIIRKEGLPDAVVWNPWEKKA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G260430`
TK1151 ID	TkA02G260430
OH-1004 ID	LXL04_029557
Relationship / confidence	Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G260430`
Location	Chr02:66429981-66432431 (+)
Description	Similar to Putative glucose-6-phosphate 1-epimerase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_029557` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0005975 carbohydrate metabolic process Biological Process GO:0006974 DNA damage response Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0030246 carbohydrate binding Molecular Function GO:0047938 glucose-6-phosphate 1-epimerase activity Molecular Function
KEGG gene cross-reference	ecj:JW1769 eco:b1780 ecoc:C3026_10155 hin:HI_1317 sce:YMR099C stm:STM1289 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.726

Rank 1 · TkA02G260430 · TK1151

Nucleus0.357

Rank 2 · TkA02G260430 · TK1151

Mitochondrion0.108

Rank 3 · TkA02G260430 · TK1151

Cell membrane0.052

Rank 4 · TkA02G260430 · TK1151

Peroxisome0.049

Rank 5 · TkA02G260430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01263Aldose_epim26-300 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G260430	`PF01263`	Aldose_epim	26	300	2.5e-65	221.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card