TkA02G260340 | RubberDandelionOmics

Gene overview

TkA02G260340

Reference: TK1151 Chr: Chr02 Coordinates: 66407319-66409934 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1485 bp · TkA02G260340|TK1151|cDNA

GAGCGCTTTGGGACTCCAATTTCTTGTTCCACTGTCACTTTTGCGCACCAACTGATCTTTGTATTTCACCTCAGTCCTCCAATTCGTCGAAGAAAACTCATAACGATCGATACATCAAATCATCAAATCTTATCTGTGAATTCTGATTCCGATCTTACGCAGATCGTCGCCAGAGAAATCCCCGACCTTCTTTATCCACCATCCGACGAAGCATAATTAGATAGTGTTGTTGTCAAGGAAGAAATGCGTAGCCGGGGATC...

CDS

Download CDS FASTA

948 bp · TkA02G260340|TK1151|CDS

ATGCGTAGCCGGGGATCCAACAACCGGCTATCGTCTTCTCGTTCCTTGTTTCAATGGAGAATTGCATCTCTCATTTTATCTATGTTTGCCACCATGGCTGCCTTCTTCGTTGCCTGCCGATTGTGGCAGGAGGCTGAATCTAGGGTTTATCTAGTTAAAGAGCTCGACAGGAGAACCGGTCAGGGGGAGTCTGCCATATCTGTAGATGACACACTTAGAGTCATAGAATGCAGGGAACAACAAAAGAAGTTATCAGTGCT...

Protein

Download Protein FASTA

315 aa · TkA02G260340|TK1151|PROTEIN

MRSRGSNNRLSSSRSLFQWRIASLILSMFATMAAFFVACRLWQEAESRVYLVKELDRRTGQGESAISVDDTLRVIECREQQKKLSVLQIDLNKAKKEGFVSNHVTETKGTNEKKQVLAVIGIVTGFGRRHNRDAIRKAWMPTGTTLKNLEDEKGIIIRFVIGRSSNREDSSDSDIMNENKKTNDFLILNDHVETPEEQPKKTKLFFVNALQHWDAEFYVKVNDDIYLNIDALGAILSSHVDKPRAYIGCMKSGVTNGMNQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G260340`
TK1151 ID	TkA02G260340
OH-1004 ID	LXL04_029558
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.200
Protein coverage (%)	TK1151 80.317 / OH-1004 73.623 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G260340

Location Chr02:66407319-66409934 (+)

Description Similar to HPTG1: Hydroxyproline O-galactosyltransferase HPGT1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g53340`	Possesses hydroxyproline O-galactosyltransferase activity.	No verified direct reference in this release
`At4g32120`	Possesses hydroxyproline O-galactosyltransferase activity.	Identification of three potent hydroxyproline O-galactosyltransferases in Arabidopsis.2015 · DOI: 10.1111/tpj.12764
`At2g25300`	Possesses hydroxyproline O-galactosyltransferase activity.	Identification of three potent hydroxyproline O-galactosyltransferases in Arabidopsis.2015 · DOI: 10.1111/tpj.12764
`At1g22015`	Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal glycosyl residue.	No verified direct reference in this release
`At1g77810`	Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal glycosyl residue.	Identification of a novel group of putative Arabidopsis thaliana beta-(1,3)-galactosyltransferases.2008 · DOI: 10.1007/s11103-008-9351-3

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029558 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009101 glycoprotein biosynthetic process Biological Process

GO:0010208 pollen wall assembly Biological Process

GO:0010405 arabinogalactan protein metabolic process Biological Process

GO:0030244 cellulose biosynthetic process Biological Process

GO:0180062 protein O-linked glycosylation via galactose Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005797 Golgi medial cisterna Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0008378 galactosyltransferase activity Molecular Function

GO:1990714 hydroxyproline O-galactosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G05170

ath:AT1G11730

ath:AT2G25300

ath:AT4G32120

ath:AT5G53340

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.762

Rank 1 · TkA02G260340 · TK1151

Endoplasmic reticulum0.083

Rank 2 · TkA02G260340 · TK1151

Cell membrane0.080

Rank 3 · TkA02G260340 · TK1151

Cytoplasm0.061

Rank 4 · TkA02G260340 · TK1151

Extracellular0.059

Rank 5 · TkA02G260340 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13334DUF409422-95 aa

PF01762Galactosyl_T131-283 aa

PF13334DUF4094167-184 aa

PF02434Fringe206-249 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G260340	`PF13334`	DUF4094	22	95	0.0042	18.2
TkA02G260340	`PF01762`	Galactosyl_T	131	283	1.3e-20	74.8
TkA02G260340	`PF13334`	DUF4094	167	184	0.0042	18.2
TkA02G260340	`PF02434`	Fringe	206	249	0.021	14.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94F27`	Arabidopsis thaliana	sp\|Q94F27\|B3GTB_ARATH Hydroxyproline O-galactosyltransferase HPGT1	58.500%	Swiss-Prot	High
`Q94A05`	Arabidopsis thaliana	sp\|Q94A05\|B3GTA_ARATH Hydroxyproline O-galactosyltransferase HPGT2	44.600%	Swiss-Prot	Medium
`Q5XEZ1`	Arabidopsis thaliana	sp\|Q5XEZ1\|B3GT9_ARATH Hydroxyproline O-galactosyltransferase HPGT3	45.000%	Swiss-Prot	Medium
`Q9LM60`	Arabidopsis thaliana	sp\|Q9LM60\|B3GT5_ARATH Probable beta-1,3-galactosyltransferase 5	49.400%	Swiss-Prot	Low
`Q6NQB7`	Arabidopsis thaliana	sp\|Q6NQB7\|B3GT7_ARATH Beta-1,3-galactosyltransferase 7	47.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card