TkA02G197120 | RubberDandelionOmics

Gene overview

TkA02G197120

Reference: TK1151 Chr: Chr02 Coordinates: 50487347-50491948 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1741 bp · TkA02G197120|TK1151|cDNA

CACTACTAGAAAAGTAAGGGTTCCTACGAAATTTTCCCACGAAATGTTTTTGTAGGAACTTCCTACGTATTTCCTACCCATTTCCTAAAAAAAACCTTTTTTTTTTAAGATTTAATGATTGTGGTAAATCTCTCGAAAATTCCTACCAATTTCCCACGAACTTATATTTTTTTGGTTTCCGTAGGAAATGCCTCGGAATTTCCTACCCATTTCCCAGGACTCCCATTTTGTTTAAATAAACTTTTACGACTTATCGGTCC...

CDS

Download CDS FASTA

441 bp · TkA02G197120|TK1151|CDS

ATGAGGAACTGGAGTTATCTGAGGCATCTTGTGAGGAAGATAATACACGGTCAAATTCCAGTCAATCTGGACAAAAGCAGCCAGCCTTCATATGATGGTCGCATGGGATGTCAGGATGAATGTCTGAATAGGATGCTGAATATAGAATGTGTAAAAGGAACATGTCCATGTGGAGATTTTTGTTCTAATCAACAGTTTCAAAAACGCAAATATTCAAAACTGAAATGTTTTCCATGTGGAAAGAAGGGTTTTGGGCTTCA...

Protein

Download Protein FASTA

146 aa · TkA02G197120|TK1151|PROTEIN

MRNWSYLRHLVRKIIHGQIPVNLDKSSQPSYDGRMGCQDECLNRMLNIECVKGTCPCGDFCSNQQFQKRKYSKLKCFPCGKKGFGLQLQEDIPKGLLFLIAFHFLVLDMPAYEARQKEYTSKGHKHFYFMTLNGSEVSPHKINYGK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G197120`
TK1151 ID	TkA02G197120
OH-1004 ID	LXL04_014407
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	98.900
Protein coverage (%)	TK1151 63.699 / OH-1004 13.080 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G197120

Location Chr02:50487347-50491948 (-)

Description Similar to ASHH2: Histone-lysine N-methyltransferase ASHH2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g77300`	Histone methyltransferase involved in di and tri-methylation of 'Lys-36' of histone H3 (H3K36me2 and H3K36me3).	Prevention of early flowering by expression of FLOWERING LOCUS C requires methylation of histone H3 K36.2005 · DOI: 10.1038/ncb1329 Di- and tri- but not monomethylation on histone H3 lysine 36 marks active transcription of genes involved in flowering time regulation and other processes in Arabidopsis thaliana.2008 · DOI: 10.1128/mcb.01607-07 The ASH1 HOMOLOG 2 (ASHH2) histone H3 methyltransferase is required for ovule and anther development in Arabidopsis.2009 · DOI: 10.1371/journal.pone.0007817 Autoimmunity in Arabidopsis acd11 is mediated by epigenetic regulation of an immune receptor.2010 · DOI: 10.1371/journal.ppat.1001137 Histone lysine methyltransferase SDG8 is involved in brassinosteroid-regulated gene expression in Arabidopsis thaliana.2014 · DOI: 10.1093/mp/ssu056

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014407 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000045 autophagosome assembly Biological Process

GO:0001763 morphogenesis of a branching structure Biological Process

GO:0006281 DNA repair Biological Process

GO:0006298 mismatch repair Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006368 transcription elongation by RNA polymerase II Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009555 pollen development Biological Process

GO:0009908 flower development Biological Process

GO:0009910 negative regulation of flower development Biological Process

GO:0010038 response to metal ion Biological Process

KEGG gene cross-reference

ath:AT1G76710

ath:AT1G77300

hsa:29072

mmu:235626

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.411

Rank 1 · TkA02G197120 · TK1151

Cytoplasm0.307

Rank 2 · TkA02G197120 · TK1151

Extracellular0.232

Rank 3 · TkA02G197120 · TK1151

Mitochondrion0.056

Rank 4 · TkA02G197120 · TK1151

Endoplasmic reticulum0.034

Rank 5 · TkA02G197120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17907AWS34-69 aa

PF17907AWS76-82 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G197120	`PF17907`	AWS	34	69	4.3e-15	56.2
TkA02G197120	`PF17907`	AWS	76	82	4.3e-15	56.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q2LAE1`	Arabidopsis thaliana	sp\|Q2LAE1\|ASHH2_ARATH Histone-lysine N-methyltransferase ASHH2	68.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card