TkA02G191150 | RubberDandelionOmics

Gene overview

TkA02G191150

Reference: TK1151 Chr: Chr02 Coordinates: 48991381-48994446 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1311 bp · TkA02G191150|TK1151|cDNA

CAATCCCCACGATTTTAGCTGGACTCCAAAACATTTCAAAGCGTTATCTTCTCAACCTCACCTCTGGCAGCCGATCTTCCCTCCGCGAATCACTCCGCGATCAACCTTTATCAACACCATCTGCCACCACTATCGCACCACTCAACCTCCTATCTCTTTCTACACAGATACCAACATCCAACAATAATCGCGACGGAGATGAAGTCATTAGTGTACAAGTCAGTCGTTTCTCATCATAAGGTTAAGAAGGTTTGATGTGT...

CDS

Download CDS FASTA

663 bp · TkA02G191150|TK1151|CDS

ATGGAGAGTGTGTTAACTGACTGTGTACAGAATAGTCTGCGACATCTATTATACCGCAATGCAATTTTCATGTGTGAACGCCTTTGCTCTGAGTTTCCCTCAGAGGCAAACTTGCAGTTGTTAGCTGCATGTTACTTGCAAAGCAATCAAGCTTACTCGGCTTACCATATTTTAAAGGGAACACAAATGCCTCAGTCCAGATACTTGTTTGCAATATCATGCTTCCAAATGGATCTCCTAAATGAAGCAGAAATGGCATT...

Protein

Download Protein FASTA

220 aa · TkA02G191150|TK1151|PROTEIN

MESVLTDCVQNSLRHLLYRNAIFMCERLCSEFPSEANLQLLAACYLQSNQAYSAYHILKGTQMPQSRYLFAISCFQMDLLNEAEMALCPSNEPSAEVPNGAAGHYLLGLIYRYTDRMKSVVHQFNQALSLDPLLWAAYEELCKLGAAGEARSVFGESASECIHRNKPGIRVFIRALINVVTRFFNLSFKNISEGQSTLALQVNRRILLQFNLLNYCFFKL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G191150`
TK1151 ID	TkA02G191150
OH-1004 ID	LXL04_027512
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	97.000
Protein coverage (%)	TK1151 74.545 / OH-1004 21.551 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G191150

Location Chr02:48991381-48994446 (-)

Description Similar to CDC27B: Cell division cycle protein 27 homolog B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g20000`	Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle.	Specialization of CDC27 function in the Arabidopsis thaliana anaphase-promoting complex (APC/C).2008 · DOI: 10.1111/j.1365-313x.2007.03312.x
`At3g16320`	Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle.	Specialization of CDC27 function in the Arabidopsis thaliana anaphase-promoting complex (APC/C).2008 · DOI: 10.1111/j.1365-313x.2007.03312.x Overexpression of the Arabidopsis anaphase promoting complex subunit CDC27a increases growth rate and organ size.2009 · DOI: 10.1007/s11103-009-9525-7

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027512 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007091 metaphase/anaphase transition of mitotic cell cycle Biological Process

GO:0007346 regulation of mitotic cell cycle Biological Process

GO:0009733 response to auxin Biological Process

GO:0010071 root meristem specification Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0030154 cell differentiation Biological Process

GO:0031145 anaphase-promoting complex-dependent catabolic process Biological Process

GO:0048364 root development Biological Process

GO:0048829 root cap development Biological Process

GO:0051301 cell division Biological Process

GO:0051445 regulation of meiotic cell cycle Biological Process

GO:0070936 protein K48-linked ubiquitination Biological Process

KEGG gene cross-reference

ath:AT2G20000

ath:AT3G16320

bta:540660

hsa:996

rno:360643

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.524

Rank 1 · TkA02G191150 · TK1151

Nucleus0.349

Rank 2 · TkA02G191150 · TK1151

Golgi apparatus0.111

Rank 3 · TkA02G191150 · TK1151

Mitochondrion0.090

Rank 4 · TkA02G191150 · TK1151

Endoplasmic reticulum0.081

Rank 5 · TkA02G191150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12895ANAPC316-88 aa

PF29407CFAP70_TPR_C18-96 aa

PF13428TPR_1418-43 aa

PF14559TPR_1918-59 aa

PF04049ANAPC834-67 aa

PF07719TPR_239-50 aa

PF13181TPR_840-50 aa

PF00515TPR_141-49 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G191150	`PF12895`	ANAPC3	16	88	2.5e-20	73.3
TkA02G191150	`PF29407`	CFAP70_TPR_C	18	96	0.00093	19.5
TkA02G191150	`PF13428`	TPR_14	18	43	0.044	15.2
TkA02G191150	`PF14559`	TPR_19	18	59	0.058	14.5
TkA02G191150	`PF04049`	ANAPC8	34	67	0.029	14.6
TkA02G191150	`PF07719`	TPR_2	39	50	0.0078	17.0
TkA02G191150	`PF13181`	TPR_8	40	50	0.013	16.3
TkA02G191150	`PF00515`	TPR_1	41	49	0.0024	18.3
TkA02G191150	`PF14559`	TPR_19	64	84	0.058	14.5
TkA02G191150	`PF13181`	TPR_8	66	86	0.013	16.3
TkA02G191150	`PF00515`	TPR_1	71	76	0.0024	18.3
TkA02G191150	`PF04049`	ANAPC8	99	147	0.029	14.6
TkA02G191150	`PF00515`	TPR_1	101	132	0.0024	18.3
TkA02G191150	`PF07719`	TPR_2	101	132	0.0078	17.0
TkA02G191150	`PF13428`	TPR_14	103	144	0.044	15.2
TkA02G191150	`PF12895`	ANAPC3	104	156	2.5e-20	73.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LGU6`	Arabidopsis thaliana	sp\|Q8LGU6\|CD27B_ARATH Cell division cycle protein 27 homolog B	76.200%	Swiss-Prot	High
`Q06AN9`	Arabidopsis thaliana	sp\|Q06AN9\|CD27A_ARATH Cell division cycle protein 27 homolog A	61.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card