RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G182510
Reference: TK1151 Chr: Chr02 Coordinates: 46914884-46916389 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1067 bp · TkA02G182510|TK1151|cDNA

TATGCTTCTAAATTTTCATCTCCTTCGTCTCGTAATCATCCAAATTTAGTGAACCCAAAATTGTAAACCCCATCCCCTTCAACCCTACCAACCAATCCATCACCTCCATCAGTTTCACCGGCCACCACCTTCATCACTTTCATCGAGCTCCGACTACCACTATCGTCGTCGTCTCCCTCCTAAAGTGATATCACCCACTTGCTACCGATAGATTCTTCTTCCCAAGACCAACTAACATATAAACTACCGCCATCATTCTC...

CDS

Download CDS FASTA

357 bp · TkA02G182510|TK1151|CDS

ATGTACTGCTACATCTATAACTGTTTCGGATCTCCCCAAGTGTTCATATACAGATGGACAACTAATGGGGAAGCAACCACAAATAGATCAGCTATTGGTTCTGGTTTACTGGCCCATGGAATACCAAAGGCATGTCACTTGTATAGTAATCAACTTATTTTTCCTCGTTGTTTCTTTTCACAATCAGTTTCTTTTGTCATCATCGGTAAGCCAATATATAAAGCTCATGATTTCAAATACCAGGTAATGGCCTTTCAAGT...

Protein

Download Protein FASTA

118 aa · TkA02G182510|TK1151|PROTEIN

MYCYIYNCFGSPQVFIYRWTTNGEATTNRSAIGSGLLAHGIPKACHLYSNQLIFPRCFFSQSVSFVIIGKPIYKAHDFKYQVMAFQVQIHIFDYFDRVIKYTDLILYLPEFKLFFQYF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G182510
TK1151 IDTkA02G182510
OH-1004 IDLXL04_001235
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)81.500
Protein coverage (%)TK1151 22.881 / OH-1004 3.885
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G182510
LocationChr02:46914884-46916389 (-)
DescriptionSimilar to LACS7: Long chain acyl-CoA synthetase 7, peroxisomal
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_001235 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000038 very long-chain fatty acid metabolic process Biological Process
GO:0001666 response to hypoxia Biological Process
GO:0001676 long-chain fatty acid metabolic process Biological Process
GO:0006631 fatty acid metabolic process Biological Process
GO:0006637 acyl-CoA metabolic process Biological Process
GO:0007584 response to nutrient Biological Process
GO:0008654 phospholipid biosynthetic process Biological Process
GO:0009629 response to gravity Biological Process
GO:0009651 response to salt stress Biological Process
GO:0010193 response to ozone Biological Process
GO:0010747 positive regulation of long-chain fatty acid import across plasma membrane Biological Process
GO:0015908 fatty acid transport Biological Process
KEGG gene cross-reference
ath:AT3G05970
ath:AT5G27600
hsa:23305
mmu:216739
rno:117243
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.386
Rank 1 · TkA02G182510 · TK1151
Mitochondrion0.265
Rank 2 · TkA02G182510 · TK1151
Nucleus0.241
Rank 3 · TkA02G182510 · TK1151
Cell membrane0.073
Rank 4 · TkA02G182510 · TK1151
Endoplasmic reticulum0.067
Rank 5 · TkA02G182510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser