Gene Card
Gene overview
cDNA / CDS / Protein Sequences
5545 bp · TkA02G169870|TK1151|cDNA
AAAGCACCACTTCTCATTTTATTCGTTTGACACCGTACTCCTTTATACTGTATCAAACTATCAAGAATGCTGAAACAAAAAATGAACAAATAAAACCAAATAACCAGGTTTGCCTGCTTCAATTCTCAACTTTTATCTCTTGAAAACAAGAACCCCGATTCCCCACATTTTTATTAACATAATGGCGTCTTCAAGCATCAAAAGTTTCAACCATCCATTTCGTCGCCGGAAAGTTCTGCTTCCTCACTATATCGACATAT...
2649 bp · TkA02G169870|TK1151|CDS
ATGCTAAAATTGGTTTTAAGAGTTTTACAGCAAAAATCTCTCATAAATTTCTATCATAATTCTATTGATGAAGAGTGTGTGGGGATGCATGACCATCTAGAAGAAATGGGTAGAAATATTGTTCGTCGTTCACACCCCGATATGTCTAACAAACATAGCCGATTGTGGGATAGCAAGGAAATTGAAGATGTATTGGCTAACGACTTGGGTACTGAAGCAACGAGATGTGTACAATTCTACGATGGGGAACTTAATCCAGA...
Protein
Download Protein FASTA882 aa · TkA02G169870|TK1151|PROTEIN
MLKLVLRVLQQKSLINFYHNSIDEECVGMHDHLEEMGRNIVRRSHPDMSNKHSRLWDSKEIEDVLANDLGTEATRCVQFYDGELNPETVMRGLRKMRELRFLDVAQQDVYLKQNVYSNLEINEVIQKFLNAVEYLCNWKFNQVNPYFPNALRYLRWNHYPFQYLPKTFQANDLGALEMVDSHIVQLWEQGERKVLNKLRFLDLSGPQLRTFDLGLTPNLETMRLERRRNGDLVELYLPGECLKLRSLILDGIKMRKFNLG...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G169870 |
|---|---|
| TK1151 ID | TkA02G169870 |
| OH-1004 ID | LXL04_016277 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 80.300 |
| Protein coverage (%) | TK1151 99.206 / OH-1004 60.240Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G169870 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:43543003-43549354 (+) | |||||||||
| Description | Similar to RPV1: Disease resistance protein RPV1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006952 defense response Biological Process GO:0007165 signal transduction Biological Process GO:0009626 plant-type hypersensitive response Biological Process GO:0019677 NAD+ catabolic process Biological Process GO:0042742 defense response to bacterium Biological Process GO:0043068 positive regulation of programmed cell death Biological Process GO:0050832 defense response to fungus Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0003953 NAD+ nucleosidase activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0042803 protein homodimerization activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT4G12010 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF23282WHD_ROQ13-43 aaPF17337Gal_GalNac_35kD62-113 aaPF25013LRR_Zer-180-128 aaPF12799LRR_493-104 aaPF12799LRR_4195-211 aaPF23952LRR_EndoS195-212 aaPF25013LRR_Zer-1195-207 aaPF24758LRR_At5g56370217-277 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G169870 | PF23282 | WHD_ROQ1 | 3 | 43 | 0.0008 | 20.2 |
| TkA02G169870 | PF17337 | Gal_GalNac_35kD | 62 | 113 | 0.027 | 14.8 |
| TkA02G169870 | PF25013 | LRR_Zer-1 | 80 | 128 | 0.0096 | 16.8 |
| TkA02G169870 | PF12799 | LRR_4 | 93 | 104 | 7.7e-14 | 52.1 |
| TkA02G169870 | PF12799 | LRR_4 | 195 | 211 | 7.7e-14 | 52.1 |
| TkA02G169870 | PF23952 | LRR_EndoS | 195 | 212 | 4.2e-05 | 24.5 |
| TkA02G169870 | PF25013 | LRR_Zer-1 | 195 | 207 | 0.0096 | 16.8 |
| TkA02G169870 | PF24758 | LRR_At5g56370 | 217 | 277 | 0.0014 | 19.0 |
| TkA02G169870 | PF15083 | Colipase-like | 241 | 262 | 4.7e-13 | 49.8 |
| TkA02G169870 | PF12799 | LRR_4 | 263 | 300 | 7.7e-14 | 52.1 |
| TkA02G169870 | PF12799 | LRR_4 | 286 | 323 | 7.7e-14 | 52.1 |
| TkA02G169870 | PF25013 | LRR_Zer-1 | 286 | 334 | 0.0096 | 16.8 |
| TkA02G169870 | PF15083 | Colipase-like | 296 | 332 | 4.7e-13 | 49.8 |
| TkA02G169870 | PF23952 | LRR_EndoS | 306 | 397 | 4.2e-05 | 24.5 |
| TkA02G169870 | PF12799 | LRR_4 | 340 | 371 | 7.7e-14 | 52.1 |
| TkA02G169870 | PF25013 | LRR_Zer-1 | 340 | 378 | 0.0096 | 16.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.