TkA02G168530 | RubberDandelionOmics

Gene overview

TkA02G168530

Reference: TK1151 Chr: Chr02 Coordinates: 43214090-43217200 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1308 bp · TkA02G168530|TK1151|cDNA

GGGTAAGAAATGAAATGAATTAGTCGGATCCGTAGAAAATTGGTGGATCAGGGACGTCGTCGGTGGAATTAAATCAAAAGACCGGTATTGACAAGAACCCTAATGAAAGCATGGTCTGTATTCACGTGAAATGAGGTGGAGTGTAGAAGGATAAAGTGAAATGGTGGGAGGAATTAGAGAAGAAGGTAGAAGAAGAGGAGCAGGTGTTCATCATCCAACCACTGTAACAACAACAGGCTTTAGTTTCTTTATGGATTCTG...

CDS

Download CDS FASTA

579 bp · TkA02G168530|TK1151|CDS

ATGTGGTCGTCTCTAAGGCACCGGACTCTTTCCCTCTCCTCGGAAGCTATTCATCAATGGTTGTCAGGTGCTAATCGCACGTTTTGTTCTTCGGTAATAAATGCTACAAACACCAACGGAAAAAGTGGAAATGTTGTCGAATTACTGAACTTAGAAGAGGTCGAGAAGATTCTGACAGATGTTCGAGCAGATGATGTGAGAGTAATACCTGTTAGAAATCAATCGGAGTTTACGAATTTCGTTGTTGTCGCAACCGGTCG...

Protein

Download Protein FASTA

192 aa · TkA02G168530|TK1151|PROTEIN

MWSSLRHRTLSLSSEAIHQWLSGANRTFCSSVINATNTNGKSGNVVELLNLEEVEKILTDVRADDVRVIPVRNQSEFTNFVVVATGRSQWHVRNIAQALIYKVKQKQTGAKRMLLPSVEGQEGGNWIVIDSGSLIVHALDEKARAYYNLEQLWTSKESATSKQQTQNQKELDQAFVKVRRKNNSKKPQNQSA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G168530`
TK1151 ID	TkA02G168530
OH-1004 ID	LXL04_011660
Relationship / confidence	Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable
Protein identity (%)	98.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G168530

Location Chr02:43214090-43217200 (+)

Description Similar to At1g67620: Protein Iojap-related, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g67620`	May be a ribosome silencing factor involved in organelle biogenesis and required for germination.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011660 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0017148 negative regulation of translation Biological Process

GO:0042256 cytosolic ribosome assembly Biological Process

GO:0090071 negative regulation of ribosome biogenesis Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0043023 ribosomal large subunit binding Molecular Function

KEGG gene cross-reference

ath:AT1G67620

ecc:c0728

ecj:JW5090

eco:b0637

ecoc:C3026_03185

pau:PA14_12030

sfx:S0666

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.890

Rank 1 · TkA02G168530 · TK1151

Nucleus0.066

Rank 2 · TkA02G168530 · TK1151

Cytoplasm0.059

Rank 3 · TkA02G168530 · TK1151

Plastid0.040

Rank 4 · TkA02G168530 · TK1151

Cell membrane0.010

Rank 5 · TkA02G168530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23052KH_N4BP1_2nd16-38 aa

PF02410RsfS51-173 aa

PF23052KH_N4BP1_2nd109-178 aa

PF26839DUF8272141-157 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G168530	`PF23052`	KH_N4BP1_2nd	16	38	0.15	12.8
TkA02G168530	`PF02410`	RsfS	51	173	7.7e-33	113.6
TkA02G168530	`PF23052`	KH_N4BP1_2nd	109	178	0.15	12.8
TkA02G168530	`PF26839`	DUF8272	141	157	0.17	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CAF9`	Arabidopsis thaliana	sp\|Q9CAF9\|IOJAM_ARATH Protein Iojap-related, mitochondrial	52.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card