TkA02G162040 | RubberDandelionOmics

Gene overview

TkA02G162040

Reference: TK1151 Chr: Chr02 Coordinates: 41546031-41548162 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2055 bp · TkA02G162040|TK1151|cDNA

ATGTACAGACTAAATGCAATCCGATTGGAGGAGAAAGAAAACCAAGAGAAGGAACTACGAACCCAAATCATTCAAGAAGGTGAAGAATTCATAAAAGCTTTCCATGAAAAGAGACTCCGCAACATTGAAACAAACAAACTCACCAACAGGGAAGGCGAGAAGATGTATGTAGCTAAACAAGAAACATTCCACAAAGAAGCCGACAAACAATACTGGAAATCAATAGCGGAACTAATCCCCCGTGAAGTTCCCAACATTGA...

CDS

Download CDS FASTA

516 bp · TkA02G162040|TK1151|CDS

ATGTACAGACTAAATGCAATCCGATTGGAGGAGAAAGAAAACCAAGAGAAGGAACTACGAACCCAAATCATTCAAGAAGGTGAAGAATTCATAAAAGCTTTCCATGAAAAGAGACTCCGCAACATTGAAACAAACAAACTCACCAACAGGGAAGGCGAGAAGATGTATGTAGCTAAACAAGAAACATTCCACAAAGAAGCCGACAAACAATACTGGAAATCAATAGCGGAACTAATCCCCCGTGAAGTTCCCAACATTGA...

Protein

Download Protein FASTA

171 aa · TkA02G162040|TK1151|PROTEIN

MYRLNAIRLEEKENQEKELRTQIIQEGEEFIKAFHEKRLRNIETNKLTNREGEKMYVAKQETFHKEADKQYWKSIAELIPREVPNIEKRGKKDKDKKPSITVVQGPKPGKPTDLSRLRHILVKLKHTPPAHMVPPPPPPQVPYGFILGEVPPAYSLAAFIHIVDIIILKFL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G162040`
TK1151 ID	TkA02G162040
OH-1004 ID	LXL04_027231
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	99.200
Protein coverage (%)	TK1151 77.193 / OH-1004 41.640 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G162040

Location Chr02:41546031-41548162 (-)

Description Similar to At2g20760: Clathrin light chain 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g20760`	Clathrin is the major protein of the polyhedral coat of coated pits and vesicles.	No verified direct reference in this release
`At2g40060`	Clathrin is the major protein of the polyhedral coat of coated pits and vesicles.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0679100`	Clathrin is the major protein of the polyhedral coat of coated pits and vesicles.	No verified direct reference in this release
`Os06g0731800`	Clathrin is the major protein of the polyhedral coat of coated pits and vesicles.	No verified direct reference in this release
`Os07g0461500`	Clathrin is the major protein of the polyhedral coat of coated pits and vesicles.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027231 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0071280 cellular response to copper ion Biological Process

GO:0072583 clathrin-dependent endocytosis Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009504 cell plate Cellular Component

GO:0009524 phragmoplast Cellular Component

GO:0009941 chloroplast envelope Cellular Component

KEGG gene cross-reference

ath:AT2G20760

ath:AT2G40060

ath:AT3G51890

dosa:Os04g0679100

dosa:Os06g0731800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.717

Rank 1 · TkA02G162040 · TK1151

Nucleus0.256

Rank 2 · TkA02G162040 · TK1151

Cell membrane0.091

Rank 3 · TkA02G162040 · TK1151

Mitochondrion0.064

Rank 4 · TkA02G162040 · TK1151

Endoplasmic reticulum0.042

Rank 5 · TkA02G162040 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01086Clathrin_lg_ch8-96 aa

PF25831SaeA_1st17-42 aa

PF01086Clathrin_lg_ch106-128 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G162040	`PF01086`	Clathrin_lg_ch	8	96	3e-06	28.1
TkA02G162040	`PF25831`	SaeA_1st	17	42	0.16	12.6
TkA02G162040	`PF01086`	Clathrin_lg_ch	106	128	3e-06	28.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SKU1`	Arabidopsis thaliana	sp\|Q9SKU1\|CLC1_ARATH Clathrin light chain 1	71.800%	Swiss-Prot	High
`O04209`	Arabidopsis thaliana	sp\|O04209\|CLC2_ARATH Clathrin light chain 2	59.400%	Swiss-Prot	High
`Q7XKE9`	Oryza sativa subsp. japonica	sp\|Q7XKE9\|CLC1_ORYSJ Clathrin light chain 1	75.600%	Swiss-Prot	High
`Q5Z402`	Oryza sativa subsp. japonica	sp\|Q5Z402\|CLC2_ORYSJ Clathrin light chain 2	67.700%	Swiss-Prot	High
`Q6Z3A8`	Oryza sativa subsp. japonica	sp\|Q6Z3A8\|CLC3_ORYSJ Clathrin light chain 3	56.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card