TkA02G161050 | RubberDandelionOmics

Gene overview

TkA02G161050

Reference: TK1151 Chr: Chr02 Coordinates: 41307796-41309034 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1023 bp · TkA02G161050|TK1151|cDNA

ATGGACGTAATCAACGAAGAGACCACTCCATACCAGAACCAAATTGTGCTGGATTTTGTTGATCATCTTCCCCCCGGCTATAGATTCTACCCCACTGATTCGGAACTCATTGTAGACTACCTAAATGTCAAGATCCAATCAAAGGAGAACCCAAGGTGTTGCCGGCCGATGCATGAAGTCAACATTTACTGCCACAAGCCGGAAGAACTTGCAGAACAATATTATCCCTCCTGTGAGAATACATGGTACTTTCTGACTCC...

CDS

Download CDS FASTA

1023 bp · TkA02G161050|TK1151|CDS

ATGGACGTAATCAACGAAGAGACCACTCCATACCAGAACCAAATTGTGCTGGATTTTGTTGATCATCTTCCCCCCGGCTATAGATTCTACCCCACTGATTCGGAACTCATTGTAGACTACCTAAATGTCAAGATCCAATCAAAGGAGAACCCAAGGTGTTGCCGGCCGATGCATGAAGTCAACATTTACTGCCACAAGCCGGAAGAACTTGCAGAACAATATTATCCCTCCTGTGAGAATACATGGTACTTTCTGACTCC...

Protein

Download Protein FASTA

340 aa · TkA02G161050|TK1151|PROTEIN

MDVINEETTPYQNQIVLDFVDHLPPGYRFYPTDSELIVDYLNVKIQSKENPRCCRPMHEVNIYCHKPEELAEQYYPSCENTWYFLTPRDRKYPRGNTPDRAVRNGGFWKATQKYKVYDDATRQKVGYKRSLVFYEKKDISTKWLMHEYTTNEPNLPIQNGVNGNKQNEWVLCKIYKKKQTANNNGNPIPNPKRRRVLENNETKTNTKPILNAMQPMTTFQDSSVIQPAQCYPNQISLNLSNSFPFSDGASSSGSISTGPQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G161050`
TK1151 ID	TkA02G161050
OH-1004 ID	LXL04_016290
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G161050

Location Chr02:41307796-41309034 (-)

Description Similar to NAP2: NAC domain-containing protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g61110`	Transcription factor of the NAC family.	A cis regulatory element in the TAPNAC promoter directs tapetal gene expression.2011 · DOI: 10.1007/s11103-010-9713-5
`At1g69490`	Transcription activator that binds to, and transactivates the promoter of the abscisic aldehyde oxidase AAO3.	No verified direct reference in this release
`At3g15510`	Transcription factor of the NAC family (Probable).	NAC family proteins NARS1/NAC2 and NARS2/NAM in the outer integument regulate embryogenesis in Arabidopsis.2008 · DOI: 10.1105/tpc.108.060160

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016290 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009555 pollen development Biological Process

GO:0009646 response to absence of light Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009825 multidimensional cell growth Biological Process

GO:0009835 fruit ripening Biological Process

GO:0009867 jasmonic acid mediated signaling pathway Biological Process

KEGG gene cross-reference

ath:AT1G69490

ath:AT3G15500

dosa:Os07g0566500

sly:101248665

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.943

Rank 1 · TkA02G161050 · TK1151

Cytoplasm0.138

Rank 2 · TkA02G161050 · TK1151

Cell membrane0.037

Rank 3 · TkA02G161050 · TK1151

Endoplasmic reticulum0.029

Rank 4 · TkA02G161050 · TK1151

Plastid0.012

Rank 5 · TkA02G161050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02365NAM24-149 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G161050	`PF02365`	NAM	24	149	2.6e-34	119.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GY42`	Arabidopsis thaliana	sp\|Q8GY42\|NAC25_ARATH NAC transcription factor 25	42.500%	Swiss-Prot	Low
`O49255`	Arabidopsis thaliana	sp\|O49255\|NAC29_ARATH NAC transcription factor 29	44.700%	Swiss-Prot	Low
`Q9LD44`	Arabidopsis thaliana	sp\|Q9LD44\|NAC56_ARATH NAC transcription factor 56	43.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card