TkA02G156870 | RubberDandelionOmics

Gene overview

TkA02G156870

Reference: TK1151 Chr: Chr02 Coordinates: 40210064-40210911 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

666 bp · TkA02G156870|TK1151|cDNA

AAATCACCAACAGATCATCTTTATTCTGCTCTTCAGCGGAACAACATCTACACTTACAAAGACGACGAGAGAATCAAGAAAGGGAAAAAGATCATTGATGACCTCAGCGGATCCATTGAAGACTCGAGATTCTACATCACTGTTTTCTCAAAGAACTATGCATGTTCTTCTTGGTGCTTGGAGGAGCTTGTGAAAATAATGCAGTGTCACAAGCAGATCGGACATACTGCTTACCCGGTCTTCTATGATGTGGTGGTGCC...

CDS

Download CDS FASTA

666 bp · TkA02G156870|TK1151|CDS

AAATCACCAACAGATCATCTTTATTCTGCTCTTCAGCGGAACAACATCTACACTTACAAAGACGACGAGAGAATCAAGAAAGGGAAAAAGATCATTGATGACCTCAGCGGATCCATTGAAGACTCGAGATTCTACATCACTGTTTTCTCAAAGAACTATGCATGTTCTTCTTGGTGCTTGGAGGAGCTTGTGAAAATAATGCAGTGTCACAAGCAGATCGGACATACTGCTTACCCGGTCTTCTATGATGTGGTGGTGCC...

Protein

Download Protein FASTA

221 aa · TkA02G156870|TK1151|PROTEIN

KSPTDHLYSALQRNNIYTYKDDERIKKGKKIIDDLSGSIEDSRFYITVFSKNYACSSWCLEELVKIMQCHKQIGHTAYPVFYDVVVPSEVRNQSGAFGEAFAKHENVEATGKWREALKEAADLAGWELNKTADGHGVKFIKKIVEEVSLELQSVNFRMDAKLVGMETRINDIVSSLGTASDDVGMIGIWGIGGGGKTTLARAIVRRWWEDNHGHDGSGWWC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G156870`
TK1151 ID	TkA02G156870
OH-1004 ID	LXL04_016283
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	82.500
Protein coverage (%)	TK1151 90.498 / OH-1004 19.415 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G156870`
Location	Chr02:40210064-40210911 (-)
Description	Similar to N: TMV resistance protein N
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_016283` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006952 defense response Biological Process GO:0007165 signal transduction Biological Process GO:0009626 plant-type hypersensitive response Biological Process GO:0019677 NAD+ catabolic process Biological Process GO:0043068 positive regulation of programmed cell death Biological Process GO:0050832 defense response to fungus Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0000166 nucleotide binding Molecular Function GO:0003953 NAD+ nucleosidase activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0042803 protein homodimerization activity Molecular Function
KEGG gene cross-reference	ath:AT4G16950 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.345

Rank 1 · TkA02G156870 · TK1151

Cell membrane0.233

Rank 2 · TkA02G156870 · TK1151

Endoplasmic reticulum0.216

Rank 3 · TkA02G156870 · TK1151

Extracellular0.087

Rank 4 · TkA02G156870 · TK1151

Nucleus0.086

Rank 5 · TkA02G156870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01582TIR5-153 aa

PF13676TIR_25-84 aa

PF00931NB-ARC15-44 aa

PF13238AAA_1897-131 aa

PF00931NB-ARC166-219 aa

PF20720nSTAND3184-211 aa

PF13238AAA_18186-206 aa

PF05729NACHT189-213 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G156870	`PF01582`	TIR	5	153	1.8e-39	136.1
TkA02G156870	`PF13676`	TIR_2	5	84	2.3e-09	38.5
TkA02G156870	`PF00931`	NB-ARC	15	44	8.9e-06	26.1
TkA02G156870	`PF13238`	AAA_18	97	131	0.21	12.8
TkA02G156870	`PF00931`	NB-ARC	166	219	8.9e-06	26.1
TkA02G156870	`PF20720`	nSTAND3	184	211	0.12	12.7
TkA02G156870	`PF13238`	AAA_18	186	206	0.21	12.8
TkA02G156870	`PF05729`	NACHT	189	213	0.042	14.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card