TkA02G155550 | RubberDandelionOmics

Gene overview

TkA02G155550

Reference: TK1151 Chr: Chr02 Coordinates: 39901884-39904192 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1392 bp · TkA02G155550|TK1151|cDNA

CTGACTTGCAGAAAACAAGAAACAAAATTGGAATTTCTCTTAGCTCCGTGGAACGCCTGACCAAACAAGATTGGTTATTTCCAGGAGCTAAAAGAAATTCCGCTTGGTTATTCAGATAAATTTATCTGAACACGCGATTGGTGTTGTCCGCTCTCAACGCCATCGTGAGTTCCAGATGGATCAAAGAAATCACGAAACATGTGAATGACTCAAACGGGGCGCGGTAGGCCGTCGTCCTGATTCGTTACCAAAATGATGGG...

CDS

Download CDS FASTA

681 bp · TkA02G155550|TK1151|CDS

ATGATTGGGGAAGGCGGTTTCGGGAGGGTCTACAAAGGCCACATTGCCAACAAAAACACCGACATTGCTGTAAAGAAACTCGATAGAAATAGTTACCAAGGCAATCGAGAGTTTTTGGTGGAGGTTTTGTTGTTGAGCCTTCTTCATCACACGAATCTTGTCAATTTGTTCGGATATTGCGCTGATGGTGACCAACGGATGTTAGTTTACAAGTATATGCCAAACGGCTCCCTTGAAGATCACCTCTTCAGTGAGCAAAA...

Protein

Download Protein FASTA

226 aa · TkA02G155550|TK1151|PROTEIN

MIGEGGFGRVYKGHIANKNTDIAVKKLDRNSYQGNREFLVEVLLLSLLHHTNLVNLFGYCADGDQRMLVYKYMPNGSLEDHLFSEQNHITTKVMGTYGYCAPEYALTGRLTRKSDVYSFGVVFLEIITGRRVINCSAPSDEQNLIAWAEPLFKDRRKFHLMADSSLEGRYPMKGLYQALAVAAMCLQEDATKRPVMSQVVSALEYLASGKNEEQPTGGEDSSYERE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G155550`
TK1151 ID	TkA02G155550
OH-1004 ID	LXL04_016329
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	76.500
Protein coverage (%)	TK1151 100.000 / OH-1004 78.820 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G155550

Location Chr02:39901884-39904192 (+)

Description Similar to PBL23: Probable serine/threonine-protein kinase PBL23

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g20530`	May be involved in plant defense signaling.	No verified direct reference in this release
`At5g18610`	May act as a receptor-like cytoplasmic kinase in chitin-induced immune signaling.	Selective regulation of the chitin-induced defense response by the Arabidopsis receptor-like cytoplasmic kinase PBL27.2014 · DOI: 10.1111/tpj.12535 The Arabidopsis CERK1-associated kinase PBL27 connects chitin perception to MAPK activation.2016 · DOI: 10.15252/embj.201694248
`At5g02800`	Serine/threonine-protein kinase involved in the positive regulation of brassinosteroid (BR) signaling and plant growth.	No verified direct reference in this release
`At5g13160`	Protein kinase required for plant defense mechanism mediated by the disease resistance (R) protein RPS5.	The Arabidopsis PBS1 resistance gene encodes a member of a novel protein kinase subfamily.2001 · DOI: 10.1046/j.1365-313x.2001.01014.x Cleavage of Arabidopsis PBS1 by a bacterial type III effector.2003 · DOI: 10.1126/science.1085671 Indirect activation of a plant nucleotide binding site-leucine-rich repeat protein by a bacterial protease.2007 · DOI: 10.1073/pnas.0608779104 Receptor-like cytoplasmic kinases integrate signaling from multiple plant immune receptors and are targeted by a Pseudomonas syringae effector.2010 · DOI: 10.1016/j.chom.2010.03.007 Activation of a plant nucleotide binding-leucine rich repeat disease resistance protein by a modified self protein.2012 · DOI: 10.1111/j.1462-5822.2012.01779.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0372100`	Functions as an immediate downstream signaling partner of CERK1 in the microbial peptidoglycans (PGNs) and fungal chitin signaling pathways that mediate innate immunity.	A receptor-like cytoplasmic kinase targeted by a plant pathogen effector is directly phosphorylated by the chitin receptor and mediates rice immunity.2013 · DOI: 10.1016/j.chom.2013.02.007

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016329 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002221 pattern recognition receptor signaling pathway Biological Process

GO:0002758 innate immune response-activating signaling pathway Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0006952 defense response Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0043410 positive regulation of MAPK cascade Biological Process

GO:0045087 innate immune response Biological Process

GO:0045088 regulation of innate immune response Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0071323 cellular response to chitin Biological Process

KEGG gene cross-reference

ath:AT3G20530

ath:AT5G02800

ath:AT5G13160

ath:AT5G18610

dosa:Os05g0372100

osa:4338592

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.612

Rank 1 · TkA02G155550 · TK1151

Cytoplasm0.334

Rank 2 · TkA02G155550 · TK1151

Nucleus0.226

Rank 3 · TkA02G155550 · TK1151

Endoplasmic reticulum0.046

Rank 4 · TkA02G155550 · TK1151

Golgi apparatus0.043

Rank 5 · TkA02G155550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr2-93 aa

PF00069Pkinase2-83 aa

PF00069Pkinase88-201 aa

PF07714PK_Tyr_Ser-Thr99-203 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G155550	`PF07714`	PK_Tyr_Ser-Thr	2	93	5e-29	102.1
TkA02G155550	`PF00069`	Pkinase	2	83	2.4e-25	90.2
TkA02G155550	`PF00069`	Pkinase	88	201	2.4e-25	90.2
TkA02G155550	`PF07714`	PK_Tyr_Ser-Thr	99	203	5e-29	102.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JEQ2`	Arabidopsis thaliana	sp\|F4JEQ2\|PBL23_ARATH Probable serine/threonine-protein kinase PBL23	56.400%	Swiss-Prot	High
`Q1PDV6`	Arabidopsis thaliana	sp\|Q1PDV6\|PBL27_ARATH Serine/threonine-protein kinase PBL27	54.500%	Swiss-Prot	High
`Q0WRY5`	Arabidopsis thaliana	sp\|Q0WRY5\|PBL7_ARATH Probable serine/threonine-protein kinase PBL7	53.400%	Swiss-Prot	High
`Q9FE20`	Arabidopsis thaliana	sp\|Q9FE20\|PBS1_ARATH Serine/threonine-protein kinase PBS1	51.800%	Swiss-Prot	High
`Q6I5Q6`	Oryza sativa subsp. japonica	sp\|Q6I5Q6\|RK185_ORYSJ Receptor-like cytoplasmic kinase 185	54.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card