TkA02G149050 | RubberDandelionOmics

Gene overview

TkA02G149050

Reference: TK1151 Chr: Chr02 Coordinates: 38433704-38434446 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

489 bp · TkA02G149050|TK1151|cDNA

GGTATTAAAATAAGCGTTACTTTTTGGGGAAATTATGCTCAAGAACTGGTTGATTATGTTGCAAATAATCCAGAAAGCAAGTGTTTAATACTCATTATCCAATTTGGAAAGCTAAAGATTTTTAATGGTTTTTTATTGAGTAACAACTCAATGGTTGGAACAAAGCTTTTCTTCAACAGTGACATAGAAGAAGTTAACTCTTTCAAGAAAGAGCTGTATTCACTAAAAGCTTATGACACTTCTTCAAGTACACACACGAT...

CDS

Download CDS FASTA

489 bp · TkA02G149050|TK1151|CDS

GGTATTAAAATAAGCGTTACTTTTTGGGGAAATTATGCTCAAGAACTGGTTGATTATGTTGCAAATAATCCAGAAAGCAAGTGTTTAATACTCATTATCCAATTTGGAAAGCTAAAGATTTTTAATGGTTTTTTATTGAGTAACAACTCAATGGTTGGAACAAAGCTTTTCTTCAACAGTGACATAGAAGAAGTTAACTCTTTCAAGAAAGAGCTGTATTCACTAAAAGCTTATGACACTTCTTCAAGTACACACACGAT...

Protein

Download Protein FASTA

162 aa · TkA02G149050|TK1151|PROTEIN

GIKISVTFWGNYAQELVDYVANNPESKCLILIIQFGKLKIFNGFLLSNNSMVGTKLFFNSDIEEVNSFKKELYSLKAYDTSSSTHTIGSLSLDSLRNEVMVKNKLYNISALHEIESGKSGIIVDTIKHLDGDSWYYIGCSNCRSKVPNQNDIGSLTLFFIQQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G149050`
TK1151 ID	TkA02G149050
OH-1004 ID	LXL04_030169
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	77.300
Protein coverage (%)	TK1151 95.062 / OH-1004 31.111 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G149050`
Location	Chr02:38433704-38434446 (+)
Description	Similar to RPA1A: Replication protein A 70 kDa DNA-binding subunit A
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_030169` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000723 telomere maintenance Biological Process GO:0000724 double-strand break repair via homologous recombination Biological Process GO:0006260 DNA replication Biological Process GO:0006261 DNA-templated DNA replication Biological Process GO:0006281 DNA repair Biological Process GO:0006284 base-excision repair Biological Process GO:0006289 nucleotide-excision repair Biological Process GO:0006298 mismatch repair Biological Process GO:0006310 DNA recombination Biological Process GO:0006974 DNA damage response Biological Process GO:0007004 telomere maintenance via telomerase Biological Process GO:0007131 reciprocal meiotic recombination Biological Process
KEGG gene cross-reference	ath:AT2G06510 ath:AT5G08020 dosa:Os02g0776800 hsa:6117 pon:100173266 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.940

Rank 1 · TkA02G149050 · TK1151

Cytoplasm0.148

Rank 2 · TkA02G149050 · TK1151

Cell membrane0.017

Rank 3 · TkA02G149050 · TK1151

Mitochondrion0.014

Rank 4 · TkA02G149050 · TK1151

Endoplasmic reticulum0.013

Rank 5 · TkA02G149050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23842Phage_tail_terminator_311-39 aa

PF13901RH_dom55-145 aa

PF08646Rep_fac-A_C69-107 aa

PF08646Rep_fac-A_C125-151 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G149050	`PF23842`	Phage_tail_terminator_3	11	39	0.19	12.5
TkA02G149050	`PF13901`	RH_dom	55	145	0.082	13.5
TkA02G149050	`PF08646`	Rep_fac-A_C	69	107	0.24	11.9
TkA02G149050	`PF08646`	Rep_fac-A_C	125	151	0.24	11.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card