TkA02G148830 | RubberDandelionOmics

Gene overview

TkA02G148830

Reference: TK1151 Chr: Chr02 Coordinates: 38367671-38371283 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1915 bp · TkA02G148830|TK1151|cDNA

GCTGAACGAGTCATCCCCGCCAAACACGGCAGCCGGACATCACATTCCTCGATCCCACATTCCCGCGTCTTTTGCGCTCCACAATTCCACGCAGAAGAAGAAAGATCGTGCAATTATTCGAGAATAATGGCGTTGTTGTCCGAGGAAGCTTAGCAGATCAGAAAATGCCGTAGCTCCGCTCATTTCACCAAACACCATCCGACCACCACCACCACCACCACGTCCTCCGATCCCGAACGAGGAAGATACCCACCTCCGCT...

CDS

Download CDS FASTA

1332 bp · TkA02G148830|TK1151|CDS

ATGAATATATTGTGGAAAGACCCAGGGCTTCCAACCGATTCATTCTATGAGGTTCGAGCTGAATGCAAAGATGTTCCTAAAACCAAGTTTAAAATCAAGTCGGGGAAGACACTTAGTGTAAGAAAGTGGAAGTCGGCATTCAGTCCAGAAGGTCATCTTGATATAGGCCAAACCCTTGGTCGAATTTATCGTGGGGGGATACATCCAACAATTAGAGGAGAGGTATGGGAATTTCTACTCGGCTGTTTTGACCCTCAAAG...

Protein

Download Protein FASTA

443 aa · TkA02G148830|TK1151|PROTEIN

MNILWKDPGLPTDSFYEVRAECKDVPKTKFKIKSGKTLSVRKWKSAFSPEGHLDIGQTLGRIYRGGIHPTIRGEVWEFLLGCFDPQSTYEERQEIRLTRREEYGRLKELCTYMFPLVGSGKFITAPVTTEDGTPTQDPIVLLEANPEKLMTPTTQATINSGAEVSCPKEEDKKIIQWKLTLHQIGLDVVRTDRTLVFYEKQENLAKLWDVLAVYAWFDKDVGYGQGMSDLCSPMIMLLEDEADAFWCFERLMRRLRENFK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G148830`
TK1151 ID	TkA02G148830
OH-1004 ID	LXL04_016372
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G148830

Location Chr02:38367671-38371283 (-)

Description Similar to RABGAP22: Rab GTPase-activating protein 22

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g53570`	Involved in defense response against fungal and bacterial pathogens.	RabGAP22 is required for defense to the vascular pathogen Verticillium longisporum and contributes to stomata immunity.2014 · DOI: 10.1371/journal.pone.0088187

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016372 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0032889 regulation of vacuole fusion, non-autophagic Biological Process

GO:0043087 regulation of GTPase activity Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005770 late endosome Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT5G53570

cgr:2886868

hsa:64786

mmu:66687

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.611

Rank 1 · TkA02G148830 · TK1151

Nucleus0.314

Rank 2 · TkA02G148830 · TK1151

Cell membrane0.137

Rank 3 · TkA02G148830 · TK1151

Golgi apparatus0.099

Rank 4 · TkA02G148830 · TK1151

Lysosome / Vacuole0.073

Rank 5 · TkA02G148830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00566RabGAP-TBC70-94 aa

PF00566RabGAP-TBC167-327 aa

PF23436RabGap-TBC_2206-325 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G148830	`PF00566`	RabGAP-TBC	70	94	2.7e-36	126.0
TkA02G148830	`PF00566`	RabGAP-TBC	167	327	2.7e-36	126.0
TkA02G148830	`PF23436`	RabGap-TBC_2	206	325	9.1e-12	45.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94BY9`	Arabidopsis thaliana	sp\|Q94BY9\|GAP22_ARATH Rab GTPase-activating protein 22	29.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card