TkA02G148650 | RubberDandelionOmics

Gene overview

TkA02G148650

Reference: TK1151 Chr: Chr02 Coordinates: 38313346-38313864 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

486 bp · TkA02G148650|TK1151|cDNA

ATGGCAAAACTTGCAATCCTTGCCCTCGCCTTCACGGCCATCGTAGCATTCGCTGAGGTCTCCGCCTACACAACAACCACCATCACCACCGTCATAGAGGAGGAGCCGACGACAGGATCACGGTCGCAGTCACAAGGGCAGCAGTGTCGCCGCCAAATCCCGAGCCAGCAGGTGAGCCACTGCCAGGACGATCAGACCATCAGGATGCCGGTGGACCCGAGACAACAGCAACCGCACCTTCAACTGTGCTGCCAACAGCT...

CDS

Download CDS FASTA

486 bp · TkA02G148650|TK1151|CDS

ATGGCAAAACTTGCAATCCTTGCCCTCGCCTTCACGGCCATCGTAGCATTCGCTGAGGTCTCCGCCTACACAACAACCACCATCACCACCGTCATAGAGGAGGAGCCGACGACAGGATCACGGTCGCAGTCACAAGGGCAGCAGTGTCGCCGCCAAATCCCGAGCCAGCAGGTGAGCCACTGCCAGGACGATCAGACCATCAGGATGCCGGTGGACCCGAGACAACAGCAACCGCACCTTCAACTGTGCTGCCAACAGCT...

Protein

Download Protein FASTA

161 aa · TkA02G148650|TK1151|PROTEIN

MAKLAILALAFTAIVAFAEVSAYTTTTITTVIEEEPTTGSRSQSQGQQCRRQIPSQQVSHCQDDQTIRMPVDPRQQQPHLQLCCQQLQNVEEECQCDAINQAFEEAQRRQQREQQQQGGRRGGQEQQGGRQMMQQMTRRAEQIPNQCKLQVQQCRIQGRWF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G148650`
TK1151 ID	TkA02G148650
OH-1004 ID	LXL04_016375
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	93.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G148650`
Location	Chr02:38313346-38313864 (-)
Description	Similar to 2S albumin
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_016375` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0010431 seed maturation Biological Process GO:0000322 storage vacuole Cellular Component GO:0033095 aleurone grain Cellular Component GO:0043245 extraorganismal space Cellular Component GO:0045735 nutrient reservoir activity Molecular Function
KEGG gene cross-reference	rcu:8280732 rcu:8280733 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.538

Rank 1 · TkA02G148650 · TK1151

Cytoplasm0.192

Rank 2 · TkA02G148650 · TK1151

Lysosome / Vacuole0.138

Rank 3 · TkA02G148650 · TK1151

Endoplasmic reticulum0.098

Rank 4 · TkA02G148650 · TK1151

Nucleus0.071

Rank 5 · TkA02G148650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02706Wzz4-50 aa

PF25861PglZ_2nd17-32 aa

PF12300RhlB33-77 aa

PF05091eIF-3_zeta51-142 aa

PF00234Tryp_alpha_amyl61-154 aa

PF12300RhlB88-135 aa

PF25861PglZ_2nd95-149 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G148650	`PF02706`	Wzz	4	50	0.05	14.6
TkA02G148650	`PF25861`	PglZ_2nd	17	32	0.62	11.2
TkA02G148650	`PF12300`	RhlB	33	77	2.5	9.3
TkA02G148650	`PF05091`	eIF-3_zeta	51	142	8.1	6.0
TkA02G148650	`PF00234`	Tryp_alpha_amyl	61	154	5.4e-05	24.1
TkA02G148650	`PF12300`	RhlB	88	135	2.5	9.3
TkA02G148650	`PF25861`	PglZ_2nd	95	149	0.62	11.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card